SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30079.Seq
         (413 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AL031632-2|CAA21005.2|  789|Caenorhabditis elegans Hypothetical ...    28   3.1  
AF024494-9|AAB70333.1|  336|Caenorhabditis elegans Serpentine re...    27   5.4  
Z71264-4|CAA95831.1|  348|Caenorhabditis elegans Hypothetical pr...    27   7.1  

>AL031632-2|CAA21005.2|  789|Caenorhabditis elegans Hypothetical
           protein Y32B12B.2 protein.
          Length = 789

 Score = 27.9 bits (59), Expect = 3.1
 Identities = 17/43 (39%), Positives = 21/43 (48%)
 Frame = +3

Query: 273 FHALLVCSLLHFCYYXXISTSSLAVCLDLNNSHYRRPLFISTY 401
           F  L   SLL  C +    TSS ++      S  RRP+F STY
Sbjct: 356 FPDLQTVSLLFKCIFHAQMTSSWSMESKKEKSSKRRPIFESTY 398


>AF024494-9|AAB70333.1|  336|Caenorhabditis elegans Serpentine
           receptor, class u protein27 protein.
          Length = 336

 Score = 27.1 bits (57), Expect = 5.4
 Identities = 12/39 (30%), Positives = 20/39 (51%), Gaps = 1/39 (2%)
 Frame = +3

Query: 297 LLHFCYYXXISTSSLAV-CLDLNNSHYRRPLFISTYYAS 410
           +  F Y   ++T      C  ++ +HY   L+ISTYY +
Sbjct: 85  IFDFVYIRLMTTGMFTSWCASVSPNHYLMVLYISTYYVN 123


>Z71264-4|CAA95831.1|  348|Caenorhabditis elegans Hypothetical
           protein K07G5.5 protein.
          Length = 348

 Score = 26.6 bits (56), Expect = 7.1
 Identities = 16/46 (34%), Positives = 22/46 (47%)
 Frame = +3

Query: 267 IYFHALLVCSLLHFCYYXXISTSSLAVCLDLNNSHYRRPLFISTYY 404
           I    +L   ++ FCY    STSSL + +DL N    R L +   Y
Sbjct: 181 IVIQTVLKGIIMWFCYKRG-STSSLVIAMDLRNDLMTRSLALVCGY 225


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 7,716,594
Number of Sequences: 27780
Number of extensions: 127294
Number of successful extensions: 216
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 211
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 216
length of database: 12,740,198
effective HSP length: 74
effective length of database: 10,684,478
effective search space used: 673122114
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -