SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30074.Seq
         (450 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF125442-7|AAD12796.1|  203|Caenorhabditis elegans Hypothetical ...    28   3.6  
AF016436-3|AAC25896.1|  331|Caenorhabditis elegans Serpentine re...    28   3.6  
Z80223-4|CAB02318.1|  229|Caenorhabditis elegans Hypothetical pr...    27   6.3  
AF024494-9|AAB70333.1|  336|Caenorhabditis elegans Serpentine re...    27   6.3  
AL032632-5|CAA21585.1|  297|Caenorhabditis elegans Hypothetical ...    27   8.3  
AL031632-2|CAA21005.2|  789|Caenorhabditis elegans Hypothetical ...    27   8.3  

>AF125442-7|AAD12796.1|  203|Caenorhabditis elegans Hypothetical
           protein H04M03.11 protein.
          Length = 203

 Score = 27.9 bits (59), Expect = 3.6
 Identities = 16/42 (38%), Positives = 23/42 (54%), Gaps = 2/42 (4%)
 Frame = -2

Query: 206 HLNYSLLGRYF--YLSGGLSV*LKILQFVLKLMI*IRQSDHS 87
           H NY+    YF  Y+ GG+ V L ++  VL + I   + DHS
Sbjct: 43  HENYNRKSSYFLHYILGGILVVLCLISIVLFIKICEMKKDHS 84


>AF016436-3|AAC25896.1|  331|Caenorhabditis elegans Serpentine
           receptor, class j protein40 protein.
          Length = 331

 Score = 27.9 bits (59), Expect = 3.6
 Identities = 18/56 (32%), Positives = 27/56 (48%), Gaps = 3/56 (5%)
 Frame = +2

Query: 266 CIYFHALLVCSLLHFCY-YIFISTSSLAVCLDLNNSHYRRP--LFISTYYASIWYI 424
           C    A     L+HF Y Y+ I  SSL       N H+     +F+S ++ SIW++
Sbjct: 96  CSLVGATFALILVHFVYRYLAIQNSSLT----RENFHWYMTGSIFVSVFHFSIWHL 147


>Z80223-4|CAB02318.1|  229|Caenorhabditis elegans Hypothetical
           protein F26D10.11 protein.
          Length = 229

 Score = 27.1 bits (57), Expect = 6.3
 Identities = 15/55 (27%), Positives = 22/55 (40%)
 Frame = +2

Query: 278 HALLVCSLLHFCYYIFISTSSLAVCLDLNNSHYRRPLFISTYYASIWYINK*YLL 442
           HA ++CS LHF  ++F+    +       N   R       Y   +  I   YLL
Sbjct: 108 HAFILCSWLHFFAFVFMLAGCVLYPYGWENPRVREICESKKYQLGLCQIRWPYLL 162


>AF024494-9|AAB70333.1|  336|Caenorhabditis elegans Serpentine
           receptor, class u protein27 protein.
          Length = 336

 Score = 27.1 bits (57), Expect = 6.3
 Identities = 13/46 (28%), Positives = 23/46 (50%), Gaps = 4/46 (8%)
 Frame = +2

Query: 287 LVCSLLHFCYYIFISTSSLAV----CLDLNNSHYRRPLFISTYYAS 412
           L C L     +++I   +  +    C  ++ +HY   L+ISTYY +
Sbjct: 78  LTCVLFFIFDFVYIRLMTTGMFTSWCASVSPNHYLMVLYISTYYVN 123


>AL032632-5|CAA21585.1|  297|Caenorhabditis elegans Hypothetical
           protein Y11D7A.9 protein.
          Length = 297

 Score = 26.6 bits (56), Expect = 8.3
 Identities = 15/51 (29%), Positives = 23/51 (45%), Gaps = 1/51 (1%)
 Frame = +2

Query: 263 YCIYFHALLVCSLLHFCYYIFISTSSLAVCLDLNN-SHYRRPLFISTYYAS 412
           + I+F+   +C ++H    IF    SL         S+Y + LF S Y  S
Sbjct: 171 HVIFFYVFGICGIVHMISNIFCHAHSLYYLNPYGRLSYYLKILFTSLYVLS 221


>AL031632-2|CAA21005.2|  789|Caenorhabditis elegans Hypothetical
           protein Y32B12B.2 protein.
          Length = 789

 Score = 26.6 bits (56), Expect = 8.3
 Identities = 17/43 (39%), Positives = 21/43 (48%)
 Frame = +2

Query: 275 FHALLVCSLLHFCYYIFISTSSLAVCLDLNNSHYRRPLFISTY 403
           F  L   SLL  C +    TSS ++      S  RRP+F STY
Sbjct: 356 FPDLQTVSLLFKCIFHAQMTSSWSMESKKEKSSKRRPIFESTY 398


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 9,163,517
Number of Sequences: 27780
Number of extensions: 160855
Number of successful extensions: 269
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 268
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 269
length of database: 12,740,198
effective HSP length: 75
effective length of database: 10,656,698
effective search space used: 788595652
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -