SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30059.Seq
         (702 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z82080-8|CAD92382.3|  404|Caenorhabditis elegans Hypothetical pr...    35   0.065
AL032625-7|CAN86642.1|  404|Caenorhabditis elegans Hypothetical ...    35   0.065
AL023854-1|CAH60790.2|  404|Caenorhabditis elegans Hypothetical ...    35   0.065
Z68299-5|CAI46584.1|  111|Caenorhabditis elegans Hypothetical pr...    29   4.3  
Z78537-1|CAB01719.1|  182|Caenorhabditis elegans Hypothetical pr...    27   9.8  
U21310-3|AAA62522.2| 1288|Caenorhabditis elegans Hypothetical pr...    27   9.8  

>Z82080-8|CAD92382.3|  404|Caenorhabditis elegans Hypothetical
           protein W09G3.7a protein.
          Length = 404

 Score = 34.7 bits (76), Expect = 0.065
 Identities = 22/72 (30%), Positives = 36/72 (50%)
 Frame = +2

Query: 356 PMRSSFAERFDITNIACGYGFTVASIKTSEQHKVFGTGINTDSQIGYHFTTRNXPLELLL 535
           P R ++     I  I+ G+GF++ + K    ++++G GIN   QIG   T  N   +  +
Sbjct: 57  PKRIAYFNTKSIKFISSGFGFSLFASK----NRLYGAGINNRFQIGGQLTNINKYQDYYI 112

Query: 536 SYAPIYIPYKEL 571
           S   I IP  E+
Sbjct: 113 SAKKINIPGDEI 124


>AL032625-7|CAN86642.1|  404|Caenorhabditis elegans Hypothetical
           protein W09G3.7a protein.
          Length = 404

 Score = 34.7 bits (76), Expect = 0.065
 Identities = 22/72 (30%), Positives = 36/72 (50%)
 Frame = +2

Query: 356 PMRSSFAERFDITNIACGYGFTVASIKTSEQHKVFGTGINTDSQIGYHFTTRNXPLELLL 535
           P R ++     I  I+ G+GF++ + K    ++++G GIN   QIG   T  N   +  +
Sbjct: 57  PKRIAYFNTKSIKFISSGFGFSLFASK----NRLYGAGINNRFQIGGQLTNINKYQDYYI 112

Query: 536 SYAPIYIPYKEL 571
           S   I IP  E+
Sbjct: 113 SAKKINIPGDEI 124


>AL023854-1|CAH60790.2|  404|Caenorhabditis elegans Hypothetical
           protein W09G3.7a protein.
          Length = 404

 Score = 34.7 bits (76), Expect = 0.065
 Identities = 22/72 (30%), Positives = 36/72 (50%)
 Frame = +2

Query: 356 PMRSSFAERFDITNIACGYGFTVASIKTSEQHKVFGTGINTDSQIGYHFTTRNXPLELLL 535
           P R ++     I  I+ G+GF++ + K    ++++G GIN   QIG   T  N   +  +
Sbjct: 57  PKRIAYFNTKSIKFISSGFGFSLFASK----NRLYGAGINNRFQIGGQLTNINKYQDYYI 112

Query: 536 SYAPIYIPYKEL 571
           S   I IP  E+
Sbjct: 113 SAKKINIPGDEI 124


>Z68299-5|CAI46584.1|  111|Caenorhabditis elegans Hypothetical
          protein T04B2.8 protein.
          Length = 111

 Score = 28.7 bits (61), Expect = 4.3
 Identities = 11/24 (45%), Positives = 15/24 (62%)
 Frame = +3

Query: 24 FALNTLDYYRYNLFFXCGMLGNLI 95
          F L  L+ + +NL F CG LG L+
Sbjct: 6  FGLEALNTFYFNLVFLCGFLGYLV 29


>Z78537-1|CAB01719.1|  182|Caenorhabditis elegans Hypothetical
           protein C09F12.1 protein.
          Length = 182

 Score = 27.5 bits (58), Expect = 9.8
 Identities = 12/27 (44%), Positives = 17/27 (62%)
 Frame = +2

Query: 422 VASIKTSEQHKVFGTGINTDSQIGYHF 502
           +A I  + +   F  GINT+SQ+GY F
Sbjct: 128 IAVIVYAAEWNQFTNGINTNSQLGYSF 154


>U21310-3|AAA62522.2| 1288|Caenorhabditis elegans Hypothetical protein
            F40H6.5 protein.
          Length = 1288

 Score = 27.5 bits (58), Expect = 9.8
 Identities = 14/55 (25%), Positives = 24/55 (43%)
 Frame = +2

Query: 377  ERFDITNIACGYGFTVASIKTSEQHKVFGTGINTDSQIGYHFTTRNXPLELLLSY 541
            E F       G  F ++ IKT+  H+++G G       GY  T     +  +++Y
Sbjct: 1084 EAFSARPFTRGQPFVISLIKTANSHQIYGNG-QLLINFGYRGTASQNLIGSMIAY 1137


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,535,677
Number of Sequences: 27780
Number of extensions: 314353
Number of successful extensions: 810
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 682
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 810
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1624019012
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -