SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30018.Seq
         (825 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U28929-5|AAA68348.2|  438|Caenorhabditis elegans Gaba/glycine re...    28   7.1  
Z68882-16|CAE17745.1|  118|Caenorhabditis elegans Hypothetical p...    28   9.3  
AF106576-4|AAC78176.1|  473|Caenorhabditis elegans Hypothetical ...    28   9.3  

>U28929-5|AAA68348.2|  438|Caenorhabditis elegans Gaba/glycine
           receptor family (seegbr) protein 3 protein.
          Length = 438

 Score = 28.3 bits (60), Expect = 7.1
 Identities = 12/30 (40%), Positives = 16/30 (53%)
 Frame = +1

Query: 343 YSCTKDSRVYEWNIEDGSVKQTYNISIENN 432
           YSCT       +NI +   ++ YNIS E N
Sbjct: 370 YSCTSKCNSVRYNINNNDDEELYNISGETN 399


>Z68882-16|CAE17745.1|  118|Caenorhabditis elegans Hypothetical
           protein C47E12.13 protein.
          Length = 118

 Score = 27.9 bits (59), Expect = 9.3
 Identities = 13/32 (40%), Positives = 19/32 (59%)
 Frame = -1

Query: 318 QGGHFSAKMFGGHPNIYYFRLIIEYINSLPFV 223
           +G  F  K+FG H N+Y F  +  Y+  LPF+
Sbjct: 73  EGSKFFRKVFG-HENVYRFHFLPRYL--LPFI 101


>AF106576-4|AAC78176.1|  473|Caenorhabditis elegans Hypothetical
           protein W07E6.2 protein.
          Length = 473

 Score = 27.9 bits (59), Expect = 9.3
 Identities = 12/32 (37%), Positives = 18/32 (56%)
 Frame = +1

Query: 298 SAKVTALDWSRKYGLYSCTKDSRVYEWNIEDG 393
           +A VT L W  +  +YS ++D  V  W  +DG
Sbjct: 237 TASVTCLRWGGEGLIYSGSQDRTVKMWRADDG 268


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,658,845
Number of Sequences: 27780
Number of extensions: 337596
Number of successful extensions: 701
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 677
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 701
length of database: 12,740,198
effective HSP length: 80
effective length of database: 10,517,798
effective search space used: 2040452812
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -