SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30011.Seq
         (628 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z48334-1|CAA88308.1|  214|Caenorhabditis elegans Hypothetical pr...   142   2e-34
Z68338-7|CAA92756.2|  866|Caenorhabditis elegans Hypothetical pr...    27   8.3  

>Z48334-1|CAA88308.1|  214|Caenorhabditis elegans Hypothetical
           protein F10B5.1 protein.
          Length = 214

 Score =  142 bits (343), Expect = 2e-34
 Identities = 63/85 (74%), Positives = 68/85 (80%)
 Frame = +1

Query: 1   RPARCYRYXKNKPYPKSRXXRGVPDPKIRIFDLGKXXAXVDDFPLCVHLVSDEYEQLSSE 180
           RPARCYRY KNKPYPKSR  RGVPD KIRIFDLG   A VD FP CVH++S+E E LSSE
Sbjct: 4   RPARCYRYIKNKPYPKSRFCRGVPDAKIRIFDLGNKRANVDTFPACVHMMSNEREHLSSE 63

Query: 181 ALEAGRICCNXYLVKNCGXDQFHIR 255
           ALEA RIC N Y+VKNCG D FH+R
Sbjct: 64  ALEAARICANKYMVKNCGKDGFHLR 88



 Score =  100 bits (240), Expect = 7e-22
 Identities = 51/98 (52%), Positives = 67/98 (68%), Gaps = 1/98 (1%)
 Frame = +3

Query: 255 MRLHPFHVIRINKMLSCAGADXLQTGMRXAFGKPQGTVARVRIGQXIMSVRL**QVEGTG 434
           +R HPFHV RINKMLSCAGAD LQTGMR A+GKPQG VARV IG  + S+R+  +     
Sbjct: 89  VRKHPFHVTRINKMLSCAGADRLQTGMRGAYGKPQGLVARVDIGDILFSMRI--KEGNVK 146

Query: 435 HRGSA-PSPSFKFPGRAKDLRIKEVGFTKYERDEFXKL 545
           H   A     FKFPGR   +  ++ GFTK++R+++ ++
Sbjct: 147 HAIEAFRRAKFKFPGRQIIVSSRKWGFTKWDREDYERM 184


>Z68338-7|CAA92756.2|  866|Caenorhabditis elegans Hypothetical
           protein T24B8.4 protein.
          Length = 866

 Score = 27.5 bits (58), Expect = 8.3
 Identities = 17/50 (34%), Positives = 24/50 (48%)
 Frame = +2

Query: 125 TFHCACTWCPTNMNS*AQRLWRQDVSAAIXTS*RTAXXISSISDETSPFP 274
           T+  A T  PTN NS     WR    +A+  S   +   SS+S  ++P P
Sbjct: 492 TYGYAPTAAPTN-NSRGTNTWRSTSPSAVEPSGGMSPISSSVSSASAPSP 540


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,972,302
Number of Sequences: 27780
Number of extensions: 247872
Number of successful extensions: 540
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 527
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 539
length of database: 12,740,198
effective HSP length: 78
effective length of database: 10,573,358
effective search space used: 1374536540
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -