SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B18
         (656 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z77660-3|CAB01171.1|  471|Caenorhabditis elegans Hypothetical pr...    31   0.72 
Z73970-3|CAA98242.2|  773|Caenorhabditis elegans Hypothetical pr...    30   1.7  
AC024796-10|AAK29896.1|  623|Caenorhabditis elegans Hypothetical...    30   1.7  
AF134186-1|AAD55361.1| 1359|Caenorhabditis elegans XNP-1 protein.      29   2.2  
AF000196-11|AAC24256.1| 1359|Caenorhabditis elegans Human xnp ge...    29   2.2  
U41992-7|AAA83358.1|  374|Caenorhabditis elegans Hypothetical pr...    29   2.9  
AL021172-1|CAA15962.1|  315|Caenorhabditis elegans Hypothetical ...    29   2.9  
AF056579-1|AAC78601.1|  315|Caenorhabditis elegans high mobility...    29   2.9  
Z93377-9|CAE17792.1|  350|Caenorhabditis elegans Hypothetical pr...    29   3.8  
U58748-10|AAB52970.2|  701|Caenorhabditis elegans Hypothetical p...    29   3.8  
AF106576-1|AAC78177.2|  664|Caenorhabditis elegans Hypothetical ...    29   3.8  
Z49068-5|CAA88863.2|  707|Caenorhabditis elegans Hypothetical pr...    28   5.1  
U80447-7|AAB37811.1|  518|Caenorhabditis elegans Hypothetical pr...    28   6.7  
U29488-10|AAK93843.1|  813|Caenorhabditis elegans Dnaj domain (p...    28   6.7  
AC024824-1|AAK85503.1|  679|Caenorhabditis elegans Hypothetical ...    28   6.7  
Z82274-5|CAB05227.1|  333|Caenorhabditis elegans Hypothetical pr...    27   8.9  
U97403-8|AAB52470.1|  720|Caenorhabditis elegans Hypothetical pr...    27   8.9  
U64855-1|AAB04980.1|  594|Caenorhabditis elegans Hypothetical pr...    27   8.9  
U41992-8|AAA83359.1|  754|Caenorhabditis elegans Hypothetical pr...    27   8.9  

>Z77660-3|CAB01171.1|  471|Caenorhabditis elegans Hypothetical
           protein F38H4.3 protein.
          Length = 471

 Score = 31.1 bits (67), Expect = 0.72
 Identities = 19/54 (35%), Positives = 29/54 (53%)
 Frame = +1

Query: 427 ENKKRERQITPSPELKKASSDEEEVISLPTKRKRIRLNPVDSDDSDVENKADNK 588
           E  + E +I  + ELKKA    +E  +L  +    +  P  S+DSDVE + DN+
Sbjct: 154 EEDRTEAEIDEN-ELKKALKKSDEAPALKGRSGISKEMPSGSEDSDVEVEGDNR 206


>Z73970-3|CAA98242.2|  773|Caenorhabditis elegans Hypothetical
           protein C29A12.3a protein.
          Length = 773

 Score = 29.9 bits (64), Expect = 1.7
 Identities = 22/70 (31%), Positives = 30/70 (42%)
 Frame = +1

Query: 379 PIVMVPRKSSKKGIHLENKKRERQITPSPELKKASSDEEEVISLPTKRKRIRLNPVDSDD 558
           P+   P KSS      E KK       S   KK   D +     P ++K++   P DSD+
Sbjct: 691 PVNKSPVKSSPIKKEAEKKKGPVASIFSSSTKKNEKDVKVESPSPIRKKKL---PSDSDE 747

Query: 559 SDVENKADNK 588
           SD E   + K
Sbjct: 748 SDEETSTNKK 757


>AC024796-10|AAK29896.1|  623|Caenorhabditis elegans Hypothetical
           protein Y48G1C.7 protein.
          Length = 623

 Score = 29.9 bits (64), Expect = 1.7
 Identities = 15/44 (34%), Positives = 29/44 (65%), Gaps = 2/44 (4%)
 Frame = +1

Query: 403 SSKKGIHLEN--KKRERQITPSPELKKASSDEEEVISLPTKRKR 528
           S KK +HLE    +RE Q++ + E+++ SS +++ I LP ++ +
Sbjct: 392 SRKKNVHLEEMLDERELQVSHTEEIQQPSSSQQQ-IQLPYRKAK 434


>AF134186-1|AAD55361.1| 1359|Caenorhabditis elegans XNP-1 protein.
          Length = 1359

 Score = 29.5 bits (63), Expect = 2.2
 Identities = 16/65 (24%), Positives = 30/65 (46%)
 Frame = +1

Query: 394 PRKSSKKGIHLENKKRERQITPSPELKKASSDEEEVISLPTKRKRIRLNPVDSDDSDVEN 573
           PRKSSKK       + E   +   E +K S  +++V     ++ + +     S+D D + 
Sbjct: 75  PRKSSKKSRKRAKSESESDESDEEEDRKKSKSKKKVDQKKKEKSKKKRTTSSSEDEDSDE 134

Query: 574 KADNK 588
           + + K
Sbjct: 135 EREQK 139



 Score = 28.3 bits (60), Expect = 5.1
 Identities = 21/65 (32%), Positives = 30/65 (46%)
 Frame = +1

Query: 394 PRKSSKKGIHLENKKRERQITPSPELKKASSDEEEVISLPTKRKRIRLNPVDSDDSDVEN 573
           P K SKKG+    KK+ +      E +  S DE+EV     K K++     +S+D   E 
Sbjct: 192 PSKKSKKGL----KKKAKS-----ESESESEDEKEVKKSKKKSKKVVKKESESEDEAPEK 242

Query: 574 KADNK 588
           K   K
Sbjct: 243 KKTEK 247



 Score = 27.9 bits (59), Expect = 6.7
 Identities = 15/65 (23%), Positives = 28/65 (43%)
 Frame = +1

Query: 397 RKSSKKGIHLENKKRERQITPSPELKKASSDEEEVISLPTKRKRIRLNPVDSDDSDVENK 576
           RK SK    ++ KK+E+             D +E     +K+K  +     S +S  E++
Sbjct: 101 RKKSKSKKKVDQKKKEKSKKKRTTSSSEDEDSDEEREQKSKKKSKKTKKQTSSESSEESE 160

Query: 577 ADNKI 591
            + K+
Sbjct: 161 EERKV 165


>AF000196-11|AAC24256.1| 1359|Caenorhabditis elegans Human xnp gene
           related protein 1 protein.
          Length = 1359

 Score = 29.5 bits (63), Expect = 2.2
 Identities = 16/65 (24%), Positives = 30/65 (46%)
 Frame = +1

Query: 394 PRKSSKKGIHLENKKRERQITPSPELKKASSDEEEVISLPTKRKRIRLNPVDSDDSDVEN 573
           PRKSSKK       + E   +   E +K S  +++V     ++ + +     S+D D + 
Sbjct: 75  PRKSSKKSRKRAKSESESDESDEEEDRKKSKSKKKVDQKKKEKSKKKRTTSSSEDEDSDE 134

Query: 574 KADNK 588
           + + K
Sbjct: 135 EREQK 139



 Score = 28.3 bits (60), Expect = 5.1
 Identities = 21/65 (32%), Positives = 30/65 (46%)
 Frame = +1

Query: 394 PRKSSKKGIHLENKKRERQITPSPELKKASSDEEEVISLPTKRKRIRLNPVDSDDSDVEN 573
           P K SKKG+    KK+ +      E +  S DE+EV     K K++     +S+D   E 
Sbjct: 192 PSKKSKKGL----KKKAKS-----ESESESEDEKEVKKSKKKSKKVVKKESESEDEAPEK 242

Query: 574 KADNK 588
           K   K
Sbjct: 243 KKTEK 247



 Score = 27.9 bits (59), Expect = 6.7
 Identities = 15/65 (23%), Positives = 28/65 (43%)
 Frame = +1

Query: 397 RKSSKKGIHLENKKRERQITPSPELKKASSDEEEVISLPTKRKRIRLNPVDSDDSDVENK 576
           RK SK    ++ KK+E+             D +E     +K+K  +     S +S  E++
Sbjct: 101 RKKSKSKKKVDQKKKEKSKKKRTTSSSEDEDSDEEREQKSKKKSKKTKKQTSSESSEESE 160

Query: 577 ADNKI 591
            + K+
Sbjct: 161 EERKV 165


>U41992-7|AAA83358.1|  374|Caenorhabditis elegans Hypothetical
           protein F32E10.6 protein.
          Length = 374

 Score = 29.1 bits (62), Expect = 2.9
 Identities = 15/50 (30%), Positives = 26/50 (52%)
 Frame = +1

Query: 427 ENKKRERQITPSPELKKASSDEEEVISLPTKRKRIRLNPVDSDDSDVENK 576
           ++KK +R  TP  E      +EEEV+  P K K+ +      ++ +VE +
Sbjct: 239 KSKKSKRAETPEEE----DDEEEEVVKTPKKTKKSKRAETPEEEDEVEEE 284


>AL021172-1|CAA15962.1|  315|Caenorhabditis elegans Hypothetical
           protein Y17G7A.1 protein.
          Length = 315

 Score = 29.1 bits (62), Expect = 2.9
 Identities = 17/67 (25%), Positives = 33/67 (49%)
 Frame = +1

Query: 391 VPRKSSKKGIHLENKKRERQITPSPELKKASSDEEEVISLPTKRKRIRLNPVDSDDSDVE 570
           V  ++  + +   + KRE     SP    A++++ +++S P KR R R     S D+DV 
Sbjct: 57  VKNETDSEAVGSSSVKRENSANDSP----ANTNDVDIVSSPVKRGRGRKAKNPSADADVN 112

Query: 571 NKADNKI 591
           +   + +
Sbjct: 113 DTGSSPV 119


>AF056579-1|AAC78601.1|  315|Caenorhabditis elegans high mobility
           group protein I beta protein.
          Length = 315

 Score = 29.1 bits (62), Expect = 2.9
 Identities = 17/67 (25%), Positives = 33/67 (49%)
 Frame = +1

Query: 391 VPRKSSKKGIHLENKKRERQITPSPELKKASSDEEEVISLPTKRKRIRLNPVDSDDSDVE 570
           V  ++  + +   + KRE     SP    A++++ +++S P KR R R     S D+DV 
Sbjct: 57  VKNETDSEAVGSSSVKRENSANDSP----ANTNDVDIVSSPVKRGRGRKAKNPSADADVN 112

Query: 571 NKADNKI 591
           +   + +
Sbjct: 113 DTGSSPV 119


>Z93377-9|CAE17792.1|  350|Caenorhabditis elegans Hypothetical
           protein F13A7.13 protein.
          Length = 350

 Score = 28.7 bits (61), Expect = 3.8
 Identities = 20/69 (28%), Positives = 35/69 (50%), Gaps = 3/69 (4%)
 Frame = -3

Query: 282 STLL*FEYESYLRLLY*IFIFTYYRAKVYFL---MIYHLTFIFILLSQKST*VKIILITE 112
           +T+L  +YES  R    IF+  Y++A   FL   M++H+  +  LL   +    ++ +  
Sbjct: 151 ATVLFSDYESIYRKKLSIFLIIYHQAYAIFLALVMLFHVFPLRNLLGMNA--CGLLFVIP 208

Query: 111 HYYF*RNIN 85
           H +F R  N
Sbjct: 209 HLFFLRYYN 217


>U58748-10|AAB52970.2|  701|Caenorhabditis elegans Hypothetical
           protein ZK180.6 protein.
          Length = 701

 Score = 28.7 bits (61), Expect = 3.8
 Identities = 15/44 (34%), Positives = 24/44 (54%)
 Frame = +3

Query: 288 NSTGAANTLFNYFTKTPPTNKKLKADATEDTDCNGSPKKQ*KRN 419
           N+T A+N  FN  T  P TN+K     TE  D + +P  + +++
Sbjct: 458 NTTPASNLDFNQVTVEPNTNQKPAIIQTEGDDYDTAPLNEDRKD 501


>AF106576-1|AAC78177.2|  664|Caenorhabditis elegans Hypothetical
           protein W07E6.1 protein.
          Length = 664

 Score = 28.7 bits (61), Expect = 3.8
 Identities = 18/64 (28%), Positives = 32/64 (50%), Gaps = 1/64 (1%)
 Frame = +1

Query: 400 KSSKKGIHLENK-KRERQITPSPELKKASSDEEEVISLPTKRKRIRLNPVDSDDSDVENK 576
           K+++K  + +NK + E   +   E +K +  E      P K+++ +    D DDSD +N 
Sbjct: 526 KAAQKSQNKKNKAEAEASESSDDEEEKKNGVEVNGQKKPAKKQQQKKQKADGDDSDDDNN 585

Query: 577 ADNK 588
           A  K
Sbjct: 586 APMK 589


>Z49068-5|CAA88863.2|  707|Caenorhabditis elegans Hypothetical
           protein K01C8.5 protein.
          Length = 707

 Score = 28.3 bits (60), Expect = 5.1
 Identities = 15/55 (27%), Positives = 28/55 (50%), Gaps = 3/55 (5%)
 Frame = +1

Query: 433 KKRERQITPSPELKKASSDEEE---VISLPTKRKRIRLNPVDSDDSDVENKADNK 588
           KKR +Q+     +    S+EEE   + +  TKR+R +  P+  + +  E++   K
Sbjct: 252 KKRRKQMIERESVDSEISEEEEEEEIYNKQTKRRRSQKTPIQHNKNRTESRLHQK 306


>U80447-7|AAB37811.1|  518|Caenorhabditis elegans Hypothetical
           protein F55F8.7 protein.
          Length = 518

 Score = 27.9 bits (59), Expect = 6.7
 Identities = 10/34 (29%), Positives = 21/34 (61%)
 Frame = +1

Query: 397 RKSSKKGIHLENKKRERQITPSPELKKASSDEEE 498
           +K SKK +  E K++ +++    ++ K  SD+E+
Sbjct: 120 KKLSKKKLKEEKKEKSKKVNKEKKISKTESDDED 153


>U29488-10|AAK93843.1|  813|Caenorhabditis elegans Dnaj domain
           (prokaryotic heat shockprotein) protein 8 protein.
          Length = 813

 Score = 27.9 bits (59), Expect = 6.7
 Identities = 12/29 (41%), Positives = 16/29 (55%)
 Frame = +3

Query: 312 LFNYFTKTPPTNKKLKADATEDTDCNGSP 398
           LF+YF++ P   KK K  A +  D  G P
Sbjct: 544 LFSYFSEKPSDIKKRKPKANDVADLTGDP 572


>AC024824-1|AAK85503.1|  679|Caenorhabditis elegans Hypothetical
           protein Y55B1BR.3 protein.
          Length = 679

 Score = 27.9 bits (59), Expect = 6.7
 Identities = 20/65 (30%), Positives = 33/65 (50%), Gaps = 1/65 (1%)
 Frame = +1

Query: 394 PRKSSKKGIHLENKKRERQ-ITPSPELKKASSDEEEVISLPTKRKRIRLNPVDSDDSDVE 570
           PRKSSKK   +E    E + +  SP  KK +S  +      +K++  +    +S D++VE
Sbjct: 523 PRKSSKKSAAVEESDNEEEDVEESP--KKRTSPRKS-----SKKRAAKEESEESSDNEVE 575

Query: 571 NKADN 585
              D+
Sbjct: 576 EVEDS 580


>Z82274-5|CAB05227.1|  333|Caenorhabditis elegans Hypothetical
           protein JC8.7 protein.
          Length = 333

 Score = 27.5 bits (58), Expect = 8.9
 Identities = 14/38 (36%), Positives = 22/38 (57%)
 Frame = +1

Query: 406 SKKGIHLENKKRERQITPSPELKKASSDEEEVISLPTK 519
           +K+G   +  K E   TP PE+KK +  +E+V+ L  K
Sbjct: 2   AKRGRKRKVSKDEENTTPEPEMKKKA--DEKVVELDEK 37


>U97403-8|AAB52470.1|  720|Caenorhabditis elegans Hypothetical
           protein T10E9.2 protein.
          Length = 720

 Score = 27.5 bits (58), Expect = 8.9
 Identities = 18/69 (26%), Positives = 32/69 (46%)
 Frame = +1

Query: 358 KRTLLKIPIVMVPRKSSKKGIHLENKKRERQITPSPELKKASSDEEEVISLPTKRKRIRL 537
           KR   K  +    + SS +G  +E++    +I  +        D +E++    KRK+I +
Sbjct: 650 KREAEKRGVDWKDQSSSSEGEDMESETTTERIAGNNWNNMRLKDIKELVRTAAKRKKIDI 709

Query: 538 NPVDSDDSD 564
           +   S DSD
Sbjct: 710 SNDSSSDSD 718


>U64855-1|AAB04980.1|  594|Caenorhabditis elegans Hypothetical
           protein ZK742.2 protein.
          Length = 594

 Score = 27.5 bits (58), Expect = 8.9
 Identities = 16/72 (22%), Positives = 33/72 (45%)
 Frame = +1

Query: 370 LKIPIVMVPRKSSKKGIHLENKKRERQITPSPELKKASSDEEEVISLPTKRKRIRLNPVD 549
           + I  +++ + + K  + +++K    +IT SPE  K     E+ + + T    + L    
Sbjct: 356 ISIDDILMVQYAEKLEVDVKSKDESEKITESPEKHKIEMKNEKPVKIKTVPFGLDLKYWG 415

Query: 550 SDDSDVENKADN 585
            +  DVE   +N
Sbjct: 416 EERKDVEVPKNN 427


>U41992-8|AAA83359.1|  754|Caenorhabditis elegans Hypothetical
           protein F32E10.1 protein.
          Length = 754

 Score = 27.5 bits (58), Expect = 8.9
 Identities = 15/44 (34%), Positives = 24/44 (54%)
 Frame = +1

Query: 403 SSKKGIHLENKKRERQITPSPELKKASSDEEEVISLPTKRKRIR 534
           S  KG      +  R++  + +L+ ASSDE+   SL  KR ++R
Sbjct: 554 SEPKGSASWMVEENREVDMASDLESASSDEDIDQSLKAKRAKVR 597


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,301,198
Number of Sequences: 27780
Number of extensions: 242474
Number of successful extensions: 1124
Number of sequences better than 10.0: 19
Number of HSP's better than 10.0 without gapping: 1023
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1118
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1465835342
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -