SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B17
         (629 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U42438-3|AAF99866.1|   94|Caenorhabditis elegans Downstream of m...   109   2e-24
AF016224-3|AAC27123.1|   94|Caenorhabditis elegans cyclin kinase...   109   2e-24
AC025726-28|AAK73928.1|  118|Caenorhabditis elegans Hypothetical...   108   3e-24
Z83239-6|CAB05803.1|  324|Caenorhabditis elegans Hypothetical pr...    29   3.6  
Z49132-5|CAA88984.1|  396|Caenorhabditis elegans Hypothetical pr...    27   8.4  

>U42438-3|AAF99866.1|   94|Caenorhabditis elegans Downstream of mes
           (in same operon)protein 6 protein.
          Length = 94

 Score =  109 bits (262), Expect = 2e-24
 Identities = 41/65 (63%), Positives = 56/65 (86%)
 Frame = +2

Query: 131 YSERYTDDVYEYRHVILPPDIARMVPKSHLMTETEWRNLGVQQSPGWLHFMVHNPEPHVL 310
           YS +Y DD +EYRHV +  D+++++PK+ LM+ETEWR+LG+QQSPGW+H+M+H PE HVL
Sbjct: 10  YSNKYEDDEFEYRHVHVTKDVSKLIPKNRLMSETEWRSLGIQQSPGWMHYMIHGPERHVL 69

Query: 311 LFRRP 325
           LFRRP
Sbjct: 70  LFRRP 74


>AF016224-3|AAC27123.1|   94|Caenorhabditis elegans cyclin kinase
           subunit protein.
          Length = 94

 Score =  109 bits (262), Expect = 2e-24
 Identities = 41/65 (63%), Positives = 56/65 (86%)
 Frame = +2

Query: 131 YSERYTDDVYEYRHVILPPDIARMVPKSHLMTETEWRNLGVQQSPGWLHFMVHNPEPHVL 310
           YS +Y DD +EYRHV +  D+++++PK+ LM+ETEWR+LG+QQSPGW+H+M+H PE HVL
Sbjct: 10  YSNKYEDDEFEYRHVHVTKDVSKLIPKNRLMSETEWRSLGIQQSPGWMHYMIHGPERHVL 69

Query: 311 LFRRP 325
           LFRRP
Sbjct: 70  LFRRP 74


>AC025726-28|AAK73928.1|  118|Caenorhabditis elegans Hypothetical
           protein Y71G12B.27 protein.
          Length = 118

 Score =  108 bits (260), Expect = 3e-24
 Identities = 46/71 (64%), Positives = 54/71 (76%)
 Frame = +2

Query: 116 VDQIQYSERYTDDVYEYRHVILPPDIARMVPKSHLMTETEWRNLGVQQSPGWLHFMVHNP 295
           ++ I YS RY DD YEYRHVILP  ++R VPK  L++E EWR  GVQQS GW H+MVHNP
Sbjct: 1   MEDIYYSPRYEDDEYEYRHVILPQAVSRKVPKGRLLSEAEWRRAGVQQSLGWEHYMVHNP 60

Query: 296 EPHVLLFRRPR 328
           E H+LLFRR R
Sbjct: 61  EKHILLFRRKR 71


>Z83239-6|CAB05803.1|  324|Caenorhabditis elegans Hypothetical
           protein T09F5.10 protein.
          Length = 324

 Score = 28.7 bits (61), Expect = 3.6
 Identities = 11/35 (31%), Positives = 19/35 (54%), Gaps = 1/35 (2%)
 Frame = -2

Query: 187 RW*DDMPVF-VDVICISFRILNLVHGHYCSFNCVE 86
           RW D  P + + ++C+      +  GHYC FN ++
Sbjct: 38  RWKDSFPEYRLKMVCLKDTTRVIAVGHYCYFNALK 72


>Z49132-5|CAA88984.1|  396|Caenorhabditis elegans Hypothetical
           protein ZK666.5 protein.
          Length = 396

 Score = 27.5 bits (58), Expect = 8.4
 Identities = 15/45 (33%), Positives = 19/45 (42%), Gaps = 1/45 (2%)
 Frame = +2

Query: 113 PVDQIQYSERYTD-DVYEYRHVILPPDIARMVPKSHLMTETEWRN 244
           P   IQY   + D D Y Y   ILP  +  +   + L     WRN
Sbjct: 229 PTSWIQYRALHDDVDSYRYGICILPVGLTAVWRAAQLSCRNRWRN 273


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,239,933
Number of Sequences: 27780
Number of extensions: 272925
Number of successful extensions: 592
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 582
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 592
length of database: 12,740,198
effective HSP length: 78
effective length of database: 10,573,358
effective search space used: 1385109898
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -