SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B16
         (656 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AL161712-2|CAC70128.1|  313|Caenorhabditis elegans Hypothetical ...    29   2.9  
U39995-4|AAF99993.2|  675|Caenorhabditis elegans Potassium chann...    28   6.7  
U55365-7|AAN84869.1|  133|Caenorhabditis elegans Nuclear hormone...    27   8.9  
U55365-6|AAN84868.1|  338|Caenorhabditis elegans Nuclear hormone...    27   8.9  
AY204182-1|AAO39186.1|  338|Caenorhabditis elegans nuclear recep...    27   8.9  
AF273838-1|AAG15185.1|  273|Caenorhabditis elegans nuclear recep...    27   8.9  
AF099916-4|AAC68778.1|  189|Caenorhabditis elegans Hypothetical ...    27   8.9  

>AL161712-2|CAC70128.1|  313|Caenorhabditis elegans Hypothetical
           protein Y66D12A.3 protein.
          Length = 313

 Score = 29.1 bits (62), Expect = 2.9
 Identities = 12/24 (50%), Positives = 15/24 (62%), Gaps = 1/24 (4%)
 Frame = -1

Query: 455 CNPTRFIHTSD-FTTCSTLSQIEC 387
           CNPT F+H  + FTT S L  + C
Sbjct: 81  CNPTEFLHDVEVFTTLSALRSVIC 104


>U39995-4|AAF99993.2|  675|Caenorhabditis elegans Potassium channel,
           kvqlt familyprotein 2 protein.
          Length = 675

 Score = 27.9 bits (59), Expect = 6.7
 Identities = 18/80 (22%), Positives = 37/80 (46%), Gaps = 3/80 (3%)
 Frame = +3

Query: 135 EQDRRQLPSNRLPPIEELTLGLKQKLHLQAR---ARAAPYYIRKQEPVDLVERLLEQRAL 305
           E++ +   +NRL  +   T+    + HL       R   Y++     + + E  + Q  +
Sbjct: 334 EEENKNQQTNRLRNLAASTIQCWWRYHLATNWKPPRRYTYFVHVCYKLYVTEERINQNRV 393

Query: 306 VAEAVRRLKEKKQPCHEISV 365
           +A+ +R   EKK+P  + S+
Sbjct: 394 LAKKLREKLEKKRPIKKKSL 413


>U55365-7|AAN84869.1|  133|Caenorhabditis elegans Nuclear hormone
           receptor familyprotein 94, isoform b protein.
          Length = 133

 Score = 27.5 bits (58), Expect = 8.9
 Identities = 12/43 (27%), Positives = 23/43 (53%)
 Frame = +3

Query: 243 YYIRKQEPVDLVERLLEQRALVAEAVRRLKEKKQPCHEISVDS 371
           YY+   +P D + ++ E   L+ +  R L+E+ Q C   +V +
Sbjct: 78  YYLENNKPTDRMLKVFEALLLMEKTDRWLQEEVQMCEMYNVQA 120


>U55365-6|AAN84868.1|  338|Caenorhabditis elegans Nuclear hormone
           receptor familyprotein 94, isoform a protein.
          Length = 338

 Score = 27.5 bits (58), Expect = 8.9
 Identities = 12/43 (27%), Positives = 23/43 (53%)
 Frame = +3

Query: 243 YYIRKQEPVDLVERLLEQRALVAEAVRRLKEKKQPCHEISVDS 371
           YY+   +P D + ++ E   L+ +  R L+E+ Q C   +V +
Sbjct: 283 YYLENNKPTDRMLKVFEALLLMEKTDRWLQEEVQMCEMYNVQA 325


>AY204182-1|AAO39186.1|  338|Caenorhabditis elegans nuclear receptor
           NHR-94 protein.
          Length = 338

 Score = 27.5 bits (58), Expect = 8.9
 Identities = 12/43 (27%), Positives = 23/43 (53%)
 Frame = +3

Query: 243 YYIRKQEPVDLVERLLEQRALVAEAVRRLKEKKQPCHEISVDS 371
           YY+   +P D + ++ E   L+ +  R L+E+ Q C   +V +
Sbjct: 283 YYLENNKPTDRMLKVFEALLLMEKTDRWLQEEVQMCEMYNVQA 325


>AF273838-1|AAG15185.1|  273|Caenorhabditis elegans nuclear receptor
           NHR-94 protein.
          Length = 273

 Score = 27.5 bits (58), Expect = 8.9
 Identities = 12/43 (27%), Positives = 23/43 (53%)
 Frame = +3

Query: 243 YYIRKQEPVDLVERLLEQRALVAEAVRRLKEKKQPCHEISVDS 371
           YY+   +P D + ++ E   L+ +  R L+E+ Q C   +V +
Sbjct: 218 YYLENNKPTDRMLKVFEALLLMEKTDRWLQEEVQMCEMYNVQA 260


>AF099916-4|AAC68778.1|  189|Caenorhabditis elegans Hypothetical
           protein F54C4.1 protein.
          Length = 189

 Score = 27.5 bits (58), Expect = 8.9
 Identities = 22/78 (28%), Positives = 34/78 (43%), Gaps = 2/78 (2%)
 Frame = +3

Query: 6   IRKRNAPPTLPVSLLVSCETNFKIKTFTTMLREKSSCENRHSTEQDRRQLP--SNRLPPI 179
           ++ R    T+P    V  +   KI       RE      R   E+D RQ+   S +  P+
Sbjct: 15  LQTRQIHQTIPAGSSVFMKRQKKIDPEVAKQRET---RRRKRLEKDIRQMQKHSKKPKPV 71

Query: 180 EELTLGLKQKLHLQARAR 233
           +ELTL +K   ++  R R
Sbjct: 72  DELTLDVKSAKNIGERRR 89


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,351,036
Number of Sequences: 27780
Number of extensions: 286823
Number of successful extensions: 711
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 691
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 711
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1465835342
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -