SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B15
         (511 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AL132876-13|CAD21665.1|  117|Caenorhabditis elegans Hypothetical...    89   2e-18
U67947-1|AAB07557.2| 1147|Caenorhabditis elegans Hypothetical pr...    28   3.4  
AF003136-7|ABE73336.1| 1539|Caenorhabditis elegans Hypothetical ...    28   4.5  
Z82272-6|CAB05222.1| 1431|Caenorhabditis elegans Hypothetical pr...    27   6.0  
U40798-6|AAA81476.1| 1003|Caenorhabditis elegans Temporarily ass...    27   7.9  
AF038609-2|AAK29794.1|  226|Caenorhabditis elegans Hypothetical ...    27   7.9  
AF038609-1|AAO61425.1|  234|Caenorhabditis elegans Hypothetical ...    27   7.9  

>AL132876-13|CAD21665.1|  117|Caenorhabditis elegans Hypothetical
           protein Y105E8A.16 protein.
          Length = 117

 Score = 89.0 bits (211), Expect = 2e-18
 Identities = 40/52 (76%), Positives = 47/52 (90%)
 Frame = +1

Query: 172 HRIRITLTSRNVRSLEKVCADLINGAKKQKLRVKGPVRMPTKILRITTRKTP 327
           HRIR+TLTS+NV+ LEKVCA LI+GAK + L VKGP+RMPTK+LRITTRKTP
Sbjct: 17  HRIRLTLTSQNVKPLEKVCAQLIDGAKNEHLIVKGPIRMPTKVLRITTRKTP 68



 Score = 88.2 bits (209), Expect = 3e-18
 Identities = 37/48 (77%), Positives = 47/48 (97%)
 Frame = +2

Query: 332 GEGSKTWDRFQMRIHKRVIDLHSPSEIVKQITSINIEPGVEVEVTIAD 475
           GEGSKTWDRFQMRIHKR+I+LH+P+E+++QITSI+IEPGV++EVT AD
Sbjct: 70  GEGSKTWDRFQMRIHKRLINLHAPAEVLRQITSISIEPGVDIEVTRAD 117


>U67947-1|AAB07557.2| 1147|Caenorhabditis elegans Hypothetical
           protein H03E18.1 protein.
          Length = 1147

 Score = 28.3 bits (60), Expect = 3.4
 Identities = 12/38 (31%), Positives = 20/38 (52%)
 Frame = +1

Query: 214 LEKVCADLINGAKKQKLRVKGPVRMPTKILRITTRKTP 327
           +E V A  + G KK+  + K   + PTK    +T++ P
Sbjct: 359 VELVTAKTVEGEKKETKKPKSTTKKPTKTAAASTKRPP 396


>AF003136-7|ABE73336.1| 1539|Caenorhabditis elegans Hypothetical
            protein F28B3.1 protein.
          Length = 1539

 Score = 27.9 bits (59), Expect = 4.5
 Identities = 12/37 (32%), Positives = 21/37 (56%)
 Frame = +1

Query: 145  KPQAEVSPIHRIRITLTSRNVRSLEKVCADLINGAKK 255
            + +A+ SP HRI   +TS+N       C+ L+  A++
Sbjct: 943  RSRAQSSPDHRILTLVTSKNAEQDTATCSTLLKRAER 979


>Z82272-6|CAB05222.1| 1431|Caenorhabditis elegans Hypothetical protein
            F55G11.9 protein.
          Length = 1431

 Score = 27.5 bits (58), Expect = 6.0
 Identities = 13/33 (39%), Positives = 19/33 (57%)
 Frame = -2

Query: 510  FQKYFIGGSAYASAMVTSTSTPGSMLIEVICFT 412
            F  YF+    Y +A + +T T GS+L+ V C T
Sbjct: 958  FLLYFVS-LVYLTASLINTPTKGSLLLYVFCLT 989


>U40798-6|AAA81476.1| 1003|Caenorhabditis elegans Temporarily
           assigned gene nameprotein 158 protein.
          Length = 1003

 Score = 27.1 bits (57), Expect = 7.9
 Identities = 15/33 (45%), Positives = 20/33 (60%), Gaps = 1/33 (3%)
 Frame = -3

Query: 212 ERTL-REVRVILMR*IGETSAWGFSMSLPDTTA 117
           ERTL  E R ++MR + + S  G S+SLP   A
Sbjct: 838 ERTLLMEERTMMMRDLQKVSGGGMSLSLPPANA 870


>AF038609-2|AAK29794.1|  226|Caenorhabditis elegans Hypothetical
           protein C54E4.2a protein.
          Length = 226

 Score = 27.1 bits (57), Expect = 7.9
 Identities = 9/22 (40%), Positives = 16/22 (72%)
 Frame = +1

Query: 109 MAAAVVSGKDIEKPQAEVSPIH 174
           ++AA +S +D+EKP +   P+H
Sbjct: 14  ISAAYISSEDLEKPSSADKPVH 35


>AF038609-1|AAO61425.1|  234|Caenorhabditis elegans Hypothetical
           protein C54E4.2b protein.
          Length = 234

 Score = 27.1 bits (57), Expect = 7.9
 Identities = 9/22 (40%), Positives = 16/22 (72%)
 Frame = +1

Query: 109 MAAAVVSGKDIEKPQAEVSPIH 174
           ++AA +S +D+EKP +   P+H
Sbjct: 14  ISAAYISSEDLEKPSSADKPVH 35


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,038,583
Number of Sequences: 27780
Number of extensions: 257876
Number of successful extensions: 569
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 548
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 569
length of database: 12,740,198
effective HSP length: 76
effective length of database: 10,628,918
effective search space used: 988489374
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -