SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B14
         (558 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF003151-12|AAK18912.1|  149|Caenorhabditis elegans Ribosomal pr...   142   1e-34
AL032625-4|CAB63350.2|  792|Caenorhabditis elegans Hypothetical ...    30   0.98 
Z95621-2|CAB09131.1|  330|Caenorhabditis elegans Hypothetical pr...    29   2.3  
Z78019-9|CAB01457.1|  330|Caenorhabditis elegans Hypothetical pr...    29   2.3  
Z68301-5|CAA92620.1|  301|Caenorhabditis elegans Hypothetical pr...    29   2.3  
V00148-1|CAA23464.1|  301|Caenorhabditis elegans protein ( Caeno...    29   2.3  
J01048-1|AAA27990.1|  301|Caenorhabditis elegans protein ( C.ele...    29   2.3  
AY347575-1|AAP97869.1|  301|Caenorhabditis elegans COLlagen stru...    29   2.3  
Z81038-13|CAB02755.1|  971|Caenorhabditis elegans Hypothetical p...    29   3.0  
U39653-3|AAL56623.1| 1702|Caenorhabditis elegans Prion-like-(q/n...    29   3.0  
Z71178-2|CAA94875.1|  297|Caenorhabditis elegans Hypothetical pr...    28   4.0  
Z83127-4|CAB05631.1|  872|Caenorhabditis elegans Hypothetical pr...    28   5.2  
Z79694-6|CAB01958.1|  316|Caenorhabditis elegans Hypothetical pr...    28   5.2  
Z79694-5|CAB01961.1|  316|Caenorhabditis elegans Hypothetical pr...    28   5.2  
Z68335-1|CAA92729.1|  299|Caenorhabditis elegans Hypothetical pr...    28   5.2  
Z46791-3|CAA86757.1|  323|Caenorhabditis elegans Hypothetical pr...    28   5.2  
AL021482-3|CAA16340.3| 1499|Caenorhabditis elegans Hypothetical ...    27   6.9  
AF177199-1|AAK81894.1| 1455|Caenorhabditis elegans mutant dosage...    27   6.9  
AC024808-5|AAK29931.1|  789|Caenorhabditis elegans Hypothetical ...    27   6.9  
DQ178246-1|ABA18185.1|  482|Caenorhabditis elegans TPX2-related ...    27   9.1  
DQ178245-1|ABA18184.1|  507|Caenorhabditis elegans TPX2-related ...    27   9.1  
AF078792-2|AAC26946.1|  512|Caenorhabditis elegans Hypothetical ...    27   9.1  
AF067607-9|AAF98609.1|  460|Caenorhabditis elegans Collagen prot...    27   9.1  
AC025716-4|AAL32238.1|  482|Caenorhabditis elegans Tpx2 (targeti...    27   9.1  
AC025716-2|AAK39617.1|  507|Caenorhabditis elegans Tpx2 (targeti...    27   9.1  

>AF003151-12|AAK18912.1|  149|Caenorhabditis elegans Ribosomal
           protein, small subunitprotein 10 protein.
          Length = 149

 Score =  142 bits (345), Expect = 1e-34
 Identities = 77/158 (48%), Positives = 96/158 (60%)
 Frame = +2

Query: 56  MLMPKQNRVAIYEYLFKEGVMVAKKDYHAPKHTELEKIPNLQVIKAMQSLKSRGYVKEQF 235
           M +PK +   IYEYLF EGV VAKKD++A  H  +E + NL+VIK ++SL SR  VKEQF
Sbjct: 1   MFIPKSHTKLIYEYLFNEGVTVAKKDFNAKTHPNIEGVSNLEVIKTLKSLASRELVKEQF 60

Query: 236 AWRHFYWYLTNEGIEYLRIFLHLPPEIVPATLKRSVRTETVRRGPVGRPDAPARSAEDRS 415
           AWRH+YWYLT+ GI YLR +L LP EIVPAT+K   R   V       P A      DR 
Sbjct: 61  AWRHYYWYLTDAGILYLREYLALPAEIVPATIKTKPREIRVPHED-RAPRAAQGEKGDRE 119

Query: 416 AYRRTPAAPGVAPHDKKADVGPGSADLEFKGGYGRGRP 529
           AYR           +K  + GPG A + ++ G+GRG P
Sbjct: 120 AYRT----------EKVTEAGPGGAPV-YRAGFGRGAP 146


>AL032625-4|CAB63350.2|  792|Caenorhabditis elegans Hypothetical
           protein Y37H9A.3 protein.
          Length = 792

 Score = 30.3 bits (65), Expect = 0.98
 Identities = 15/30 (50%), Positives = 16/30 (53%)
 Frame = +2

Query: 365 GPVGRPDAPARSAEDRSAYRRTPAAPGVAP 454
           G V RP APAR A   +  R  PAAP   P
Sbjct: 33  GRVSRPAAPARGAPPAARGRPAPAAPANVP 62


>Z95621-2|CAB09131.1|  330|Caenorhabditis elegans Hypothetical
           protein ZK863.2 protein.
          Length = 330

 Score = 29.1 bits (62), Expect = 2.3
 Identities = 19/53 (35%), Positives = 22/53 (41%)
 Frame = +2

Query: 365 GPVGRPDAPARSAEDRSAYRRTPAAPGVAPHDKKADVGPGSADLEFKGGYGRG 523
           GP G P AP    E  S   R+ ++PG  P       GP   D    GG G G
Sbjct: 146 GPDGNPGAPGNDGEAGSPGTRSISSPG--PAGPAGPPGPPGPDGAPGGGSGPG 196


>Z78019-9|CAB01457.1|  330|Caenorhabditis elegans Hypothetical
           protein ZK863.2 protein.
          Length = 330

 Score = 29.1 bits (62), Expect = 2.3
 Identities = 19/53 (35%), Positives = 22/53 (41%)
 Frame = +2

Query: 365 GPVGRPDAPARSAEDRSAYRRTPAAPGVAPHDKKADVGPGSADLEFKGGYGRG 523
           GP G P AP    E  S   R+ ++PG  P       GP   D    GG G G
Sbjct: 146 GPDGNPGAPGNDGEAGSPGTRSISSPG--PAGPAGPPGPPGPDGAPGGGSGPG 196


>Z68301-5|CAA92620.1|  301|Caenorhabditis elegans Hypothetical
           protein W01B6.7 protein.
          Length = 301

 Score = 29.1 bits (62), Expect = 2.3
 Identities = 19/56 (33%), Positives = 22/56 (39%)
 Frame = +2

Query: 365 GPVGRPDAPARSAEDRSAYRRTPAAPGVAPHDKKADVGPGSADLEFKGGYGRGRPA 532
           GP G P +PA  +    A    PA P        A  GPG      +GG G   PA
Sbjct: 168 GPDGNPGSPAGPSGPGPAGPPGPAGPAGNDGAPGAPGGPGEPGASEQGGPGEPGPA 223


>V00148-1|CAA23464.1|  301|Caenorhabditis elegans protein (
           Caenorhabditis elegansgene Col-2 coding for a collagen.
           ).
          Length = 301

 Score = 29.1 bits (62), Expect = 2.3
 Identities = 19/56 (33%), Positives = 22/56 (39%)
 Frame = +2

Query: 365 GPVGRPDAPARSAEDRSAYRRTPAAPGVAPHDKKADVGPGSADLEFKGGYGRGRPA 532
           GP G P +PA  +    A    PA P        A  GPG      +GG G   PA
Sbjct: 168 GPDGNPGSPAGPSGPGPAGPPGPAGPAGNDGAPGAPGGPGEPGASEQGGPGEPGPA 223


>J01048-1|AAA27990.1|  301|Caenorhabditis elegans protein (
           C.elegans (nematode)collagen 2 (col-2) gene, complete
           cds. ).
          Length = 301

 Score = 29.1 bits (62), Expect = 2.3
 Identities = 19/56 (33%), Positives = 22/56 (39%)
 Frame = +2

Query: 365 GPVGRPDAPARSAEDRSAYRRTPAAPGVAPHDKKADVGPGSADLEFKGGYGRGRPA 532
           GP G P +PA  +    A    PA P        A  GPG      +GG G   PA
Sbjct: 168 GPDGNPGSPAGPSGPGPAGPPGPAGPAGNDGAPGAPGGPGEPGASEQGGPGEPGPA 223


>AY347575-1|AAP97869.1|  301|Caenorhabditis elegans COLlagen
           structural gene, probabledorsal and ventral cuticle
           component, from embryo to adult,but maximal in dauer
           (28.0 kD) (col-2) protein.
          Length = 301

 Score = 29.1 bits (62), Expect = 2.3
 Identities = 19/56 (33%), Positives = 22/56 (39%)
 Frame = +2

Query: 365 GPVGRPDAPARSAEDRSAYRRTPAAPGVAPHDKKADVGPGSADLEFKGGYGRGRPA 532
           GP G P +PA  +    A    PA P        A  GPG      +GG G   PA
Sbjct: 168 GPDGNPGSPAGPSGPGPAGPPGPAGPAGNDGAPGAPGGPGEPGASEQGGPGEPGPA 223


>Z81038-13|CAB02755.1|  971|Caenorhabditis elegans Hypothetical
           protein C25A1.10a protein.
          Length = 971

 Score = 28.7 bits (61), Expect = 3.0
 Identities = 13/41 (31%), Positives = 23/41 (56%)
 Frame = +2

Query: 377 RPDAPARSAEDRSAYRRTPAAPGVAPHDKKADVGPGSADLE 499
           + D+ + S++D +  ++TPA     P  KKA+    S+D E
Sbjct: 432 KADSSSDSSDDEAPAKKTPAKAAPKPASKKAESSSDSSDDE 472



 Score = 28.3 bits (60), Expect = 4.0
 Identities = 14/43 (32%), Positives = 24/43 (55%)
 Frame = +2

Query: 377 RPDAPARSAEDRSAYRRTPAAPGVAPHDKKADVGPGSADLEFK 505
           + D+ + S++D +  ++TPA     P  KKA+    S+D E K
Sbjct: 279 KADSSSDSSDDEAPAKKTPAKAAPKPVAKKAESSSDSSDDEKK 321


>U39653-3|AAL56623.1| 1702|Caenorhabditis elegans
            Prion-like-(q/n-rich)-domain-bearingprotein protein 65,
            isoform a protein.
          Length = 1702

 Score = 28.7 bits (61), Expect = 3.0
 Identities = 12/24 (50%), Positives = 16/24 (66%)
 Frame = -2

Query: 500  IQDQLSLDQHQPFYHEVQHQGQQE 429
            +Q+Q +  Q Q F H+ QHQ QQE
Sbjct: 1183 MQEQSNEQQSQVFQHQHQHQAQQE 1206


>Z71178-2|CAA94875.1|  297|Caenorhabditis elegans Hypothetical
           protein B0024.2 protein.
          Length = 297

 Score = 28.3 bits (60), Expect = 4.0
 Identities = 22/60 (36%), Positives = 26/60 (43%), Gaps = 1/60 (1%)
 Frame = +2

Query: 359 RRGPVGRPDAPARSAEDRSAYRRTPAAPGVAPHDKKADVGPGSADLEFKGG-YGRGRPAS 535
           R GP GRP  P R   +    +  PA  G A H  + D  PG      K G  GRG P +
Sbjct: 165 RPGPDGRPGQPGRKGNNGRPGQ--PAPQGNAGHPGR-DGEPGQPGNPGKDGRKGRGHPGT 221


>Z83127-4|CAB05631.1|  872|Caenorhabditis elegans Hypothetical
           protein T23F6.4 protein.
          Length = 872

 Score = 27.9 bits (59), Expect = 5.2
 Identities = 15/43 (34%), Positives = 23/43 (53%)
 Frame = +2

Query: 365 GPVGRPDAPARSAEDRSAYRRTPAAPGVAPHDKKADVGPGSAD 493
           G   +P A ++ A+D SAY+RT        H +K +  PG +D
Sbjct: 82  GDANKPRAWSKYAKDSSAYKRT--------HGEKEEANPGKSD 116


>Z79694-6|CAB01958.1|  316|Caenorhabditis elegans Hypothetical
           protein C15A11.6 protein.
          Length = 316

 Score = 27.9 bits (59), Expect = 5.2
 Identities = 19/56 (33%), Positives = 22/56 (39%)
 Frame = +2

Query: 362 RGPVGRPDAPARSAEDRSAYRRTPAAPGVAPHDKKADVGPGSADLEFKGGYGRGRP 529
           +GP G P APA+           PA    +P    A   PGS      G  GRG P
Sbjct: 153 KGPNGNPGAPAQGGGQGPPGPPGPAGSAGSPGQAGAPGNPGSPGK--SGQRGRGLP 206


>Z79694-5|CAB01961.1|  316|Caenorhabditis elegans Hypothetical
           protein C15A11.5 protein.
          Length = 316

 Score = 27.9 bits (59), Expect = 5.2
 Identities = 19/56 (33%), Positives = 22/56 (39%)
 Frame = +2

Query: 362 RGPVGRPDAPARSAEDRSAYRRTPAAPGVAPHDKKADVGPGSADLEFKGGYGRGRP 529
           +GP G P APA+           PA    +P    A   PGS      G  GRG P
Sbjct: 153 KGPNGNPGAPAQGGGQGPPGPPGPAGSAGSPGQAGAPGNPGSPGK--SGQRGRGLP 206


>Z68335-1|CAA92729.1|  299|Caenorhabditis elegans Hypothetical
           protein C29F4.1 protein.
          Length = 299

 Score = 27.9 bits (59), Expect = 5.2
 Identities = 14/41 (34%), Positives = 17/41 (41%)
 Frame = +2

Query: 365 GPVGRPDAPARSAEDRSAYRRTPAAPGVAPHDKKADVGPGS 487
           GP G+P AP +   D       P  P   P    AD  PG+
Sbjct: 225 GPQGQPGAPGQPGHDGQPGAPGPKGPNGNPGAPGADGNPGA 265


>Z46791-3|CAA86757.1|  323|Caenorhabditis elegans Hypothetical
           protein C09G5.4 protein.
          Length = 323

 Score = 27.9 bits (59), Expect = 5.2
 Identities = 17/57 (29%), Positives = 23/57 (40%)
 Frame = +2

Query: 362 RGPVGRPDAPARSAEDRSAYRRTPAAPGVAPHDKKADVGPGSADLEFKGGYGRGRPA 532
           +GP G+P  P +      A  R PA    AP    A   PG A    +  +G   P+
Sbjct: 152 QGPNGQPGHPGQGGSQGPAGPRGPAGDAGAPGQVGAPGNPGQAGRGGQRSHGLPGPS 208


>AL021482-3|CAA16340.3| 1499|Caenorhabditis elegans Hypothetical
            protein Y39A1B.3 protein.
          Length = 1499

 Score = 27.5 bits (58), Expect = 6.9
 Identities = 18/48 (37%), Positives = 21/48 (43%)
 Frame = +2

Query: 320  PATLKRSVRTETVRRGPVGRPDAPARSAEDRSAYRRTPAAPGVAPHDK 463
            P T+  S RT +       R   PA+S ED S     PAAP  A   K
Sbjct: 1432 PTTMSGSSRTTSRAANSRRRAPPPAQSDEDDSDSDDAPAAPRSAARRK 1479


>AF177199-1|AAK81894.1| 1455|Caenorhabditis elegans mutant dosage
            compensation protein protein.
          Length = 1455

 Score = 27.5 bits (58), Expect = 6.9
 Identities = 18/48 (37%), Positives = 21/48 (43%)
 Frame = +2

Query: 320  PATLKRSVRTETVRRGPVGRPDAPARSAEDRSAYRRTPAAPGVAPHDK 463
            P T+  S RT +       R   PA+S ED S     PAAP  A   K
Sbjct: 1388 PTTMSGSSRTTSRAANSRRRAPPPAQSDEDDSDSDDAPAAPRSAARRK 1435


>AC024808-5|AAK29931.1|  789|Caenorhabditis elegans Hypothetical
           protein Y53G8AM.8 protein.
          Length = 789

 Score = 27.5 bits (58), Expect = 6.9
 Identities = 12/29 (41%), Positives = 19/29 (65%)
 Frame = +2

Query: 353 TVRRGPVGRPDAPARSAEDRSAYRRTPAA 439
           T+   PVGR ++ ARS ++ SA R+ P +
Sbjct: 8   TIENTPVGRGNSGARSHKEPSAKRKKPTS 36


>DQ178246-1|ABA18185.1|  482|Caenorhabditis elegans TPX2-related
           alternative variant b protein.
          Length = 482

 Score = 27.1 bits (57), Expect = 9.1
 Identities = 23/71 (32%), Positives = 34/71 (47%), Gaps = 3/71 (4%)
 Frame = +2

Query: 302 LPPEIVP-ATLKRS--VRTETVRRGPVGRPDAPARSAEDRSAYRRTPAAPGVAPHDKKAD 472
           L P+I P AT  RS  +R   V+  P     APA + ++++A R    A G A + +   
Sbjct: 323 LTPKIRPIATANRSSILRMNVVK--PTVPAPAPADAQQNKAASRPAVPAGGAARNRQPLR 380

Query: 473 VGPGSADLEFK 505
           V PG+     K
Sbjct: 381 VNPGTPSTTIK 391


>DQ178245-1|ABA18184.1|  507|Caenorhabditis elegans TPX2-related
           alternative variant a protein.
          Length = 507

 Score = 27.1 bits (57), Expect = 9.1
 Identities = 23/71 (32%), Positives = 34/71 (47%), Gaps = 3/71 (4%)
 Frame = +2

Query: 302 LPPEIVP-ATLKRS--VRTETVRRGPVGRPDAPARSAEDRSAYRRTPAAPGVAPHDKKAD 472
           L P+I P AT  RS  +R   V+  P     APA + ++++A R    A G A + +   
Sbjct: 323 LTPKIRPIATANRSSILRMNVVK--PTVPAPAPADAQQNKAASRPAVPAGGAARNRQPLR 380

Query: 473 VGPGSADLEFK 505
           V PG+     K
Sbjct: 381 VNPGTPSTTIK 391


>AF078792-2|AAC26946.1|  512|Caenorhabditis elegans Hypothetical
           protein Y40D12A.2 protein.
          Length = 512

 Score = 27.1 bits (57), Expect = 9.1
 Identities = 13/44 (29%), Positives = 23/44 (52%)
 Frame = +2

Query: 140 APKHTELEKIPNLQVIKAMQSLKSRGYVKEQFAWRHFYWYLTNE 271
           AP   ++  +PNL   + ++S    GY+      + FYWY+ +E
Sbjct: 16  APADQQITSLPNLT--EPLRSKHYAGYLSISDVKQLFYWYVESE 57


>AF067607-9|AAF98609.1|  460|Caenorhabditis elegans Collagen protein
           102 protein.
          Length = 460

 Score = 27.1 bits (57), Expect = 9.1
 Identities = 22/76 (28%), Positives = 28/76 (36%), Gaps = 2/76 (2%)
 Frame = +2

Query: 308 PEIVPATLKRSVRTETVRRGPVGR--PDAPARSAEDRSAYRRTPAAPGVAPHDKKADVGP 481
           PE  PA    +         P G   PDA A + E  +A    PAA G     + A   P
Sbjct: 365 PEAAPAEAAPAAEGAGGGAEPAGAAAPDAAAAAPEAAAAPEAAPAAEGAGGGAEPAGAAP 424

Query: 482 GSADLEFKGGYGRGRP 529
            +A    +G  G   P
Sbjct: 425 EAAAAAPEGAGGGEAP 440


>AC025716-4|AAL32238.1|  482|Caenorhabditis elegans Tpx2 (targeting
           protein for xenopusklp2)-like protein 1, isoform b
           protein.
          Length = 482

 Score = 27.1 bits (57), Expect = 9.1
 Identities = 23/71 (32%), Positives = 34/71 (47%), Gaps = 3/71 (4%)
 Frame = +2

Query: 302 LPPEIVP-ATLKRS--VRTETVRRGPVGRPDAPARSAEDRSAYRRTPAAPGVAPHDKKAD 472
           L P+I P AT  RS  +R   V+  P     APA + ++++A R    A G A + +   
Sbjct: 323 LTPKIRPIATANRSSILRMNVVK--PTVPAPAPADAQQNKAASRPAVPAGGAARNRQPLR 380

Query: 473 VGPGSADLEFK 505
           V PG+     K
Sbjct: 381 VNPGTPSTTIK 391


>AC025716-2|AAK39617.1|  507|Caenorhabditis elegans Tpx2 (targeting
           protein for xenopusklp2)-like protein 1, isoform a
           protein.
          Length = 507

 Score = 27.1 bits (57), Expect = 9.1
 Identities = 23/71 (32%), Positives = 34/71 (47%), Gaps = 3/71 (4%)
 Frame = +2

Query: 302 LPPEIVP-ATLKRS--VRTETVRRGPVGRPDAPARSAEDRSAYRRTPAAPGVAPHDKKAD 472
           L P+I P AT  RS  +R   V+  P     APA + ++++A R    A G A + +   
Sbjct: 323 LTPKIRPIATANRSSILRMNVVK--PTVPAPAPADAQQNKAASRPAVPAGGAARNRQPLR 380

Query: 473 VGPGSADLEFK 505
           V PG+     K
Sbjct: 381 VNPGTPSTTIK 391


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,238,384
Number of Sequences: 27780
Number of extensions: 253540
Number of successful extensions: 930
Number of sequences better than 10.0: 25
Number of HSP's better than 10.0 without gapping: 850
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 926
length of database: 12,740,198
effective HSP length: 77
effective length of database: 10,601,138
effective search space used: 1144922904
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -