SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B12
         (402 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z83128-1|CAB05635.1|   92|Caenorhabditis elegans Hypothetical pr...    96   7e-21
Z77131-1|CAB00854.1|   91|Caenorhabditis elegans Hypothetical pr...    90   6e-19
AF098986-5|AAC67426.1|  671|Caenorhabditis elegans Hypothetical ...    29   1.7  
Z92777-6|CAE17682.1|  353|Caenorhabditis elegans Hypothetical pr...    28   2.2  
U41275-2|AAA82465.1|  438|Caenorhabditis elegans Hypothetical pr...    28   2.2  
U88171-2|AAB42252.1|  434|Caenorhabditis elegans Glutamate-gated...    27   6.7  
U14525-1|AAA50786.1|  434|Caenorhabditis elegans avermectin-sens...    27   6.7  

>Z83128-1|CAB05635.1|   92|Caenorhabditis elegans Hypothetical
           protein W01D2.1 protein.
          Length = 92

 Score = 96.3 bits (229), Expect = 7e-21
 Identities = 39/74 (52%), Positives = 50/74 (67%)
 Frame = +2

Query: 71  KTHTLCRRCGRSSYHIQKSKCAQCGYPAAKLRSYHWSVKAXXXXXXXXXXMRHLKIVRRR 250
           K+HTLC+RCG+SS+HIQK +CA CGYP AK R+Y+W  K+           RHL+ V  R
Sbjct: 14  KSHTLCKRCGKSSFHIQKKRCASCGYPDAKKRTYNWGAKSIRRRTTGTGRTRHLRDVNAR 73

Query: 251 FRNGFKEGKPTPPK 292
           FRNGF+EG    P+
Sbjct: 74  FRNGFREGTTPKPR 87


>Z77131-1|CAB00854.1|   91|Caenorhabditis elegans Hypothetical
           protein C54C6.1 protein.
          Length = 91

 Score = 89.8 bits (213), Expect = 6e-19
 Identities = 37/72 (51%), Positives = 47/72 (65%)
 Frame = +2

Query: 71  KTHTLCRRCGRSSYHIQKSKCAQCGYPAAKLRSYHWSVKAXXXXXXXXXXMRHLKIVRRR 250
           K+HTLC+RCG+SS+HIQK +CA CGY  AK R+Y+W  K+           RHL+ V  R
Sbjct: 14  KSHTLCKRCGKSSFHIQKKRCASCGYQDAKKRTYNWGAKSIRRRTTGTGRTRHLRDVNAR 73

Query: 251 FRNGFKEGKPTP 286
           FRNGF+   P P
Sbjct: 74  FRNGFRGTTPKP 85


>AF098986-5|AAC67426.1|  671|Caenorhabditis elegans Hypothetical
           protein C36C9.4 protein.
          Length = 671

 Score = 28.7 bits (61), Expect = 1.7
 Identities = 11/28 (39%), Positives = 15/28 (53%)
 Frame = +2

Query: 74  THTLCRRCGRSSYHIQKSKCAQCGYPAA 157
           TH  C +CG+ + +    KC  CG P A
Sbjct: 101 THHFCNKCGKVAQN--SKKCKHCGGPVA 126


>Z92777-6|CAE17682.1|  353|Caenorhabditis elegans Hypothetical
           protein C17H1.9 protein.
          Length = 353

 Score = 28.3 bits (60), Expect = 2.2
 Identities = 12/39 (30%), Positives = 23/39 (58%), Gaps = 3/39 (7%)
 Frame = +3

Query: 63  AEIRPIRYAEDVVDRH---ITFKNQNAPNVDILQQNYDP 170
           A+++ I+Y  D +++H   + F+NQ   +   L+ N DP
Sbjct: 230 ADLKKIKYTSDEIEKHKSKLEFRNQQLESSRTLEINADP 268


>U41275-2|AAA82465.1|  438|Caenorhabditis elegans Hypothetical
           protein T25D1.2 protein.
          Length = 438

 Score = 28.3 bits (60), Expect = 2.2
 Identities = 11/28 (39%), Positives = 15/28 (53%)
 Frame = +2

Query: 74  THTLCRRCGRSSYHIQKSKCAQCGYPAA 157
           TH  C +CG+ + +    KC  CG P A
Sbjct: 173 THHFCNKCGKVAQN--SKKCKYCGGPVA 198


>U88171-2|AAB42252.1|  434|Caenorhabditis elegans Glutamate-gated
           chloride channelprotein 2 protein.
          Length = 434

 Score = 26.6 bits (56), Expect = 6.7
 Identities = 15/62 (24%), Positives = 31/62 (50%)
 Frame = -1

Query: 198 LRLAFTDQW*DRNFAAGYPHWAHFDF*M*YDDLPHLLHNVWVLFRRLPKLEVPLRHLVTL 19
           ++L F +QW D   A  Y +   ++    +  +PH+  ++W+     P  +   RHL+ +
Sbjct: 80  IQLTFREQWIDPRLA--YENLGFYNPPA-FLTVPHVKKSLWIPDTFFPTEKAAHRHLIDM 136

Query: 18  DN 13
           +N
Sbjct: 137 EN 138


>U14525-1|AAA50786.1|  434|Caenorhabditis elegans
           avermectin-sensitive glutamate-gated chloride channel
           GluCl beta protein.
          Length = 434

 Score = 26.6 bits (56), Expect = 6.7
 Identities = 15/62 (24%), Positives = 31/62 (50%)
 Frame = -1

Query: 198 LRLAFTDQW*DRNFAAGYPHWAHFDF*M*YDDLPHLLHNVWVLFRRLPKLEVPLRHLVTL 19
           ++L F +QW D   A  Y +   ++    +  +PH+  ++W+     P  +   RHL+ +
Sbjct: 80  IQLTFREQWIDPRLA--YENLGFYNPPA-FLTVPHVKKSLWIPDTFFPTEKAAHRHLIDM 136

Query: 18  DN 13
           +N
Sbjct: 137 EN 138


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 7,604,041
Number of Sequences: 27780
Number of extensions: 141815
Number of successful extensions: 321
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 319
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 321
length of database: 12,740,198
effective HSP length: 74
effective length of database: 10,684,478
effective search space used: 630384202
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -