SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B11
         (654 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z82083-1|CAB04967.1|  128|Caenorhabditis elegans Hypothetical pr...   138   4e-33
U23172-2|AAM22069.2|  538|Caenorhabditis elegans Ubiquitin prote...   138   4e-33
U23172-1|AAC46525.1|  838|Caenorhabditis elegans Ubiquitin prote...   138   4e-33
M23433-1|AAA28154.1|  838|Caenorhabditis elegans polyubiquitin p...   138   4e-33
L31492-1|AAC37252.1|  128|Caenorhabditis elegans ubiquitin/ribos...   138   4e-33
L16530-1|AAA28161.1|  163|Caenorhabditis elegans ubiquitin-like:...   130   6e-31
AC006651-4|AAF39865.1|  163|Caenorhabditis elegans Ubiquitin-lik...   130   6e-31
Z78420-1|CAB01708.1|   77|Caenorhabditis elegans Hypothetical pr...    92   4e-19
AF040645-8|AAB94982.1|  292|Caenorhabditis elegans Hypothetical ...    81   5e-16
M21321-1|AAA28153.1|   37|Caenorhabditis elegans protein ( C.ele...    75   6e-14
U80452-4|AAB37860.1|  226|Caenorhabditis elegans Hypothetical pr...    58   7e-09
AF040645-9|AAB94972.2|  197|Caenorhabditis elegans Hypothetical ...    46   2e-05
AF040643-4|AAB94965.1|  110|Caenorhabditis elegans Hypothetical ...    46   2e-05
AC006651-5|AAM48542.1|   47|Caenorhabditis elegans Ubiquitin-lik...    42   3e-04
U80452-8|AAB37855.1|  244|Caenorhabditis elegans Hypothetical pr...    42   5e-04
U80452-7|AAB37856.1|  233|Caenorhabditis elegans Hypothetical pr...    38   0.006
U80452-6|AAB37858.1|  592|Caenorhabditis elegans Hypothetical pr...    37   0.011
U80452-10|AAB37853.1|  214|Caenorhabditis elegans Hypothetical p...    36   0.025
U09415-1|AAA82164.1|  655|Caenorhabditis elegans Ceprp21 protein.      35   0.058
AF106576-5|AAC78179.1|  655|Caenorhabditis elegans Yeast prp (sp...    35   0.058
Z69904-3|CAA93780.1|  372|Caenorhabditis elegans Hypothetical pr...    33   0.13 
AF099917-6|AAC68780.1|  264|Caenorhabditis elegans Hypothetical ...    32   0.31 
L16621-4|AAO12390.1| 1595|Caenorhabditis elegans Hypothetical pr...    31   0.94 
L16621-3|AAL00883.1| 1620|Caenorhabditis elegans Hypothetical pr...    31   0.94 
AF040645-10|AAB94971.2|  110|Caenorhabditis elegans Hypothetical...    30   1.2  
Z92834-5|CAB07390.1|  402|Caenorhabditis elegans Hypothetical pr...    29   3.8  
Z93395-7|CAH04744.1| 2389|Caenorhabditis elegans Hypothetical pr...    28   5.0  
Z93395-6|CAB07708.1| 3375|Caenorhabditis elegans Hypothetical pr...    28   5.0  
Z93395-4|CAB07707.1| 2295|Caenorhabditis elegans Hypothetical pr...    28   5.0  
Z93395-3|CAB07706.1| 2482|Caenorhabditis elegans Hypothetical pr...    28   5.0  
Z93375-9|CAH04704.1| 2389|Caenorhabditis elegans Hypothetical pr...    28   5.0  
Z93375-8|CAB07569.1| 3375|Caenorhabditis elegans Hypothetical pr...    28   5.0  
Z93375-7|CAB07568.1| 2295|Caenorhabditis elegans Hypothetical pr...    28   5.0  
Z93375-6|CAB07567.1| 2482|Caenorhabditis elegans Hypothetical pr...    28   5.0  
L13458-1|AAA28156.1| 2481|Caenorhabditis elegans basement membra...    28   5.0  
U80452-5|AAB37859.1|  180|Caenorhabditis elegans Hypothetical pr...    27   8.8  
U28735-6|AAF99954.1| 1493|Caenorhabditis elegans Hypothetical pr...    27   8.8  
AF003130-4|AAB54126.1| 1043|Caenorhabditis elegans Hypothetical ...    27   8.8  

>Z82083-1|CAB04967.1|  128|Caenorhabditis elegans Hypothetical
           protein ZK1010.1 protein.
          Length = 128

 Score =  138 bits (333), Expect = 4e-33
 Identities = 67/70 (95%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70


>U23172-2|AAM22069.2|  538|Caenorhabditis elegans Ubiquitin protein
           1, isoform c protein.
          Length = 538

 Score =  138 bits (333), Expect = 4e-33
 Identities = 67/70 (95%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70



 Score =  138 bits (333), Expect = 4e-33
 Identities = 67/70 (95%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 77  MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 137 IQKESTLHLV 146



 Score =  138 bits (333), Expect = 4e-33
 Identities = 67/70 (95%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 153 MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 212

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 213 IQKESTLHLV 222



 Score =  138 bits (333), Expect = 4e-33
 Identities = 67/70 (95%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 229 MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 288

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 289 IQKESTLHLV 298



 Score =  138 bits (333), Expect = 4e-33
 Identities = 67/70 (95%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 305 MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 364

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 365 IQKESTLHLV 374



 Score =  135 bits (327), Expect = 2e-32
 Identities = 66/70 (94%), Positives = 67/70 (95%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTL GKTITLEVE SDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 381 MQIFVKTLIGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 440

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 441 IQKESTLHLV 450



 Score = 91.5 bits (217), Expect = 5e-19
 Identities = 44/47 (93%), Positives = 45/47 (95%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAG 487
           MQIFVKTLTGKTITLEVE SDTIENVKAKIQDKEGIPP+QQRL FAG
Sbjct: 457 MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAG 503


>U23172-1|AAC46525.1|  838|Caenorhabditis elegans Ubiquitin protein
           1, isoform a protein.
          Length = 838

 Score =  138 bits (333), Expect = 4e-33
 Identities = 67/70 (95%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70



 Score =  138 bits (333), Expect = 4e-33
 Identities = 67/70 (95%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 77  MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 137 IQKESTLHLV 146



 Score =  138 bits (333), Expect = 4e-33
 Identities = 67/70 (95%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 153 MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 212

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 213 IQKESTLHLV 222



 Score =  138 bits (333), Expect = 4e-33
 Identities = 67/70 (95%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 229 MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 288

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 289 IQKESTLHLV 298



 Score =  138 bits (333), Expect = 4e-33
 Identities = 67/70 (95%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 305 MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 364

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 365 IQKESTLHLV 374



 Score =  138 bits (333), Expect = 4e-33
 Identities = 67/70 (95%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 457 MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 516

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 517 IQKESTLHLV 526



 Score =  138 bits (333), Expect = 4e-33
 Identities = 67/70 (95%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 533 MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 592

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 593 IQKESTLHLV 602



 Score =  138 bits (333), Expect = 4e-33
 Identities = 67/70 (95%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 609 MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 668

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 669 IQKESTLHLV 678



 Score =  138 bits (333), Expect = 4e-33
 Identities = 67/70 (95%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 685 MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 744

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 745 IQKESTLHLV 754



 Score =  138 bits (333), Expect = 4e-33
 Identities = 67/70 (95%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 761 MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 820

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 821 IQKESTLHLV 830



 Score =  135 bits (327), Expect = 2e-32
 Identities = 66/70 (94%), Positives = 67/70 (95%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTL GKTITLEVE SDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 381 MQIFVKTLIGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 440

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 441 IQKESTLHLV 450


>M23433-1|AAA28154.1|  838|Caenorhabditis elegans polyubiquitin
           protein.
          Length = 838

 Score =  138 bits (333), Expect = 4e-33
 Identities = 67/70 (95%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70



 Score =  138 bits (333), Expect = 4e-33
 Identities = 67/70 (95%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 77  MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 137 IQKESTLHLV 146



 Score =  138 bits (333), Expect = 4e-33
 Identities = 67/70 (95%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 153 MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 212

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 213 IQKESTLHLV 222



 Score =  138 bits (333), Expect = 4e-33
 Identities = 67/70 (95%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 229 MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 288

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 289 IQKESTLHLV 298



 Score =  138 bits (333), Expect = 4e-33
 Identities = 67/70 (95%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 305 MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 364

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 365 IQKESTLHLV 374



 Score =  138 bits (333), Expect = 4e-33
 Identities = 67/70 (95%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 381 MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 440

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 441 IQKESTLHLV 450



 Score =  138 bits (333), Expect = 4e-33
 Identities = 67/70 (95%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 457 MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 516

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 517 IQKESTLHLV 526



 Score =  138 bits (333), Expect = 4e-33
 Identities = 67/70 (95%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 533 MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 592

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 593 IQKESTLHLV 602



 Score =  138 bits (333), Expect = 4e-33
 Identities = 67/70 (95%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 609 MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 668

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 669 IQKESTLHLV 678



 Score =  138 bits (333), Expect = 4e-33
 Identities = 67/70 (95%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 685 MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 744

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 745 IQKESTLHLV 754



 Score =  136 bits (330), Expect = 1e-32
 Identities = 66/70 (94%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 761 MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 820

Query: 447 IQKESTLHLV 418
           IQK+STLHLV
Sbjct: 821 IQKQSTLHLV 830


>L31492-1|AAC37252.1|  128|Caenorhabditis elegans
           ubiquitin/ribosomal fusion protein protein.
          Length = 128

 Score =  138 bits (333), Expect = 4e-33
 Identities = 67/70 (95%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70


>L16530-1|AAA28161.1|  163|Caenorhabditis elegans
           ubiquitin-like:ribosomal proteinfusion protein protein.
          Length = 163

 Score =  130 bits (315), Expect = 6e-31
 Identities = 68/147 (46%), Positives = 92/147 (62%)
 Frame = -1

Query: 621 IFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQ 442
           +FVKTL  +T+ LEV  ++ + ++K KI+  EGIP  +QRL +AG+QLED    SD  I 
Sbjct: 2   VFVKTLH-RTLFLEVAANEDVLSIKQKIEAAEGIPAEEQRLCYAGRQLED----SDCGID 56

Query: 441 KESTLHLVXXXXXXXXXXXXKNYSTPXXXXXXXXXXKLAVLRFYKVDENGKIHRLRRECT 262
            E+T+++             K Y+TP          KLAVL++YK+DENGKI RLR+EC 
Sbjct: 57  SEATIYVNLELLGGAKKRKKKVYTTPKKNKRKPKKVKLAVLKYYKIDENGKITRLRKECQ 116

Query: 261 GEQCGAGVFMAVMEDRHYCGKCHSTMV 181
              CG GVFMA   +RHYCG+CH T+V
Sbjct: 117 QPSCGGGVFMAQHANRHYCGRCHDTLV 143


>AC006651-4|AAF39865.1|  163|Caenorhabditis elegans Ubiquitin-like
           family protein 1,isoform a protein.
          Length = 163

 Score =  130 bits (315), Expect = 6e-31
 Identities = 68/147 (46%), Positives = 92/147 (62%)
 Frame = -1

Query: 621 IFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQ 442
           +FVKTL  +T+ LEV  ++ + ++K KI+  EGIP  +QRL +AG+QLED    SD  I 
Sbjct: 2   VFVKTLH-RTLFLEVAANEDVLSIKQKIEAAEGIPAEEQRLCYAGRQLED----SDCGID 56

Query: 441 KESTLHLVXXXXXXXXXXXXKNYSTPXXXXXXXXXXKLAVLRFYKVDENGKIHRLRRECT 262
            E+T+++             K Y+TP          KLAVL++YK+DENGKI RLR+EC 
Sbjct: 57  SEATIYVNLELLGGAKKRKKKVYTTPKKNKRKPKKVKLAVLKYYKIDENGKITRLRKECQ 116

Query: 261 GEQCGAGVFMAVMEDRHYCGKCHSTMV 181
              CG GVFMA   +RHYCG+CH T+V
Sbjct: 117 QPSCGGGVFMAQHANRHYCGRCHDTLV 143


>Z78420-1|CAB01708.1|   77|Caenorhabditis elegans Hypothetical
           protein F45H11.2 protein.
          Length = 77

 Score = 91.9 bits (218), Expect = 4e-19
 Identities = 41/70 (58%), Positives = 53/70 (75%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           M I VKTLTGK I L++EP+D +E +K K+++KEGIPP QQRL FAGKQ+ D +T +DY 
Sbjct: 1   MLIKVKTLTGKEIELDIEPNDRVERIKEKVEEKEGIPPPQQRLIFAGKQMNDDKTAADYK 60

Query: 447 IQKESTLHLV 418
           +   S LHLV
Sbjct: 61  VLGGSVLHLV 70


>AF040645-8|AAB94982.1|  292|Caenorhabditis elegans Hypothetical
           protein F52C6.4 protein.
          Length = 292

 Score = 81.4 bits (192), Expect = 5e-16
 Identities = 36/71 (50%), Positives = 51/71 (71%)
 Frame = -1

Query: 630 KMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDY 451
           K+ + VKTL GKTI + ++ +DT+E +K K+Q+K G+PP+QQRL F   QLE+ R L  Y
Sbjct: 160 KLTVSVKTLFGKTIPISIKNTDTVETLKFKVQNKHGVPPDQQRLIFGRAQLENDRALFAY 219

Query: 450 NIQKESTLHLV 418
           NI+ E  +HLV
Sbjct: 220 NIRDEDIIHLV 230



 Score = 37.1 bits (82), Expect = 0.011
 Identities = 23/62 (37%), Positives = 34/62 (54%)
 Frame = -1

Query: 606 LTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQKESTL 427
           +TG  IT  VE SD I+++  K+ + +  P     +       +D RT+SDYNI+  STL
Sbjct: 98  VTGDPIT--VEASDAIKDLNFKVAEAQRKPHQPSNIVLC----KDQRTISDYNIKNGSTL 151

Query: 426 HL 421
            L
Sbjct: 152 RL 153



 Score = 33.9 bits (74), Expect = 0.10
 Identities = 17/36 (47%), Positives = 25/36 (69%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGI 520
           M + VKT TGKTIT+E       +NVK +++DK+G+
Sbjct: 59  MLLSVKTSTGKTITVEAP-----KNVKTEVRDKQGV 89


>M21321-1|AAA28153.1|   37|Caenorhabditis elegans protein (
           C.elegans ubiquitin A(UbiA) gene, 5' end. ).
          Length = 37

 Score = 74.5 bits (175), Expect = 6e-14
 Identities = 36/37 (97%), Positives = 36/37 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIP 517
           MQIFVKTLTGKTITLEVE SDTIENVKAKIQDKEGIP
Sbjct: 1   MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIP 37


>U80452-4|AAB37860.1|  226|Caenorhabditis elegans Hypothetical
           protein C16C8.4 protein.
          Length = 226

 Score = 57.6 bits (133), Expect = 7e-09
 Identities = 28/68 (41%), Positives = 43/68 (63%)
 Frame = -1

Query: 630 KMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDY 451
           + QIFVK L G +   ++   DT+ ++K  I+ +  IP +   L F+GK+LED  ++ DY
Sbjct: 153 EFQIFVKVL-GVSYAFKIHREDTVFDIKNDIEHRHDIPQHSYWLSFSGKRLEDHCSIGDY 211

Query: 450 NIQKESTL 427
           NIQK ST+
Sbjct: 212 NIQKSSTI 219


>AF040645-9|AAB94972.2|  197|Caenorhabditis elegans Hypothetical
           protein F52C6.3 protein.
          Length = 197

 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 29/72 (40%), Positives = 42/72 (58%), Gaps = 3/72 (4%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLE---DGRTLS 457
           ++I+V+   G+T TL+   SDT+ +VKAKI +K  I PN Q+L      L+   D  TL 
Sbjct: 103 IRIYVEN-AGRTCTLDTSASDTMASVKAKIWEKLRILPNTQKLLLENWDLDLFSDHSTLF 161

Query: 456 DYNIQKESTLHL 421
           D + +  STL L
Sbjct: 162 DNSFENGSTLRL 173



 Score = 31.1 bits (67), Expect = 0.71
 Identities = 22/64 (34%), Positives = 33/64 (51%), Gaps = 1/64 (1%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQ-LEDGRTLSDY 451
           M + +KT TGK IT+E   S     VK +++DK+G+          G Q +E   T+ D 
Sbjct: 1   MLLSIKTSTGKNITVEAPKS-----VKTEVRDKQGVVFTVSYDKGTGNQIIEMEDTVQDV 55

Query: 450 NIQK 439
            IQ+
Sbjct: 56  KIQE 59



 Score = 27.9 bits (59), Expect = 6.7
 Identities = 10/18 (55%), Positives = 15/18 (83%)
 Frame = -1

Query: 630 KMQIFVKTLTGKTITLEV 577
           ++ +FVKT TGKTIT+ +
Sbjct: 180 EIDVFVKTYTGKTITISI 197


>AF040643-4|AAB94965.1|  110|Caenorhabditis elegans Hypothetical
           protein F14D2.11 protein.
          Length = 110

 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 28/70 (40%), Positives = 36/70 (51%)
 Frame = -1

Query: 630 KMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDY 451
           K Q FV+ L GKT TL V  SDT+E  K ++           R+ + GK L D  T  +Y
Sbjct: 42  KFQYFVR-LNGKTRTLNVNASDTVEQGKMQLCHN----ARSTRMSYGGKPLSDQITFGEY 96

Query: 450 NIQKESTLHL 421
           NI   ST+ L
Sbjct: 97  NISNNSTMDL 106


>AC006651-5|AAM48542.1|   47|Caenorhabditis elegans Ubiquitin-like
           family protein 1,isoform b protein.
          Length = 47

 Score = 42.3 bits (95), Expect = 3e-04
 Identities = 20/46 (43%), Positives = 32/46 (69%)
 Frame = -1

Query: 621 IFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGK 484
           +FVKTL  +T+ LEV  ++ + ++K KI+  EGIP  +QRL +A +
Sbjct: 2   VFVKTLH-RTLFLEVAANEDVLSIKQKIEAAEGIPAEEQRLCYAAR 46


>U80452-8|AAB37855.1|  244|Caenorhabditis elegans Hypothetical
           protein C16C8.13 protein.
          Length = 244

 Score = 41.5 bits (93), Expect = 5e-04
 Identities = 25/61 (40%), Positives = 31/61 (50%)
 Frame = -1

Query: 603 TGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQKESTLH 424
           +G    L V  SDTI  VK  I     +  +  R+    K LED  TL+ YNIQ+ STL 
Sbjct: 181 SGNYRNLWVRGSDTIRQVKLTINSLANVDISSFRMVLRDKVLEDDHTLAYYNIQEGSTLG 240

Query: 423 L 421
           L
Sbjct: 241 L 241


>U80452-7|AAB37856.1|  233|Caenorhabditis elegans Hypothetical
           protein C16C8.14 protein.
          Length = 233

 Score = 37.9 bits (84), Expect = 0.006
 Identities = 22/53 (41%), Positives = 28/53 (52%)
 Frame = -1

Query: 585 LEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQKESTL 427
           L V  SDTI  +K +I    GI     R     K LED  TL+ YNI++ ST+
Sbjct: 176 LRVCGSDTIRQIKPRINSLAGIDTISFRTFCDDKFLEDDHTLAHYNIREGSTI 228


>U80452-6|AAB37858.1|  592|Caenorhabditis elegans Hypothetical
           protein C16C8.16 protein.
          Length = 592

 Score = 37.1 bits (82), Expect = 0.011
 Identities = 20/55 (36%), Positives = 31/55 (56%)
 Frame = -1

Query: 585 LEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQKESTLHL 421
           L V  SDTI ++K +I     +  +  R+   GK LED  +L+ YNIQ+ + + L
Sbjct: 210 LRVCGSDTIRHIKLRINSLAKVDISSFRMVLRGKLLEDHHSLAYYNIQEGALIWL 264


>U80452-10|AAB37853.1|  214|Caenorhabditis elegans Hypothetical
           protein C16C8.11 protein.
          Length = 214

 Score = 35.9 bits (79), Expect = 0.025
 Identities = 16/53 (30%), Positives = 30/53 (56%)
 Frame = -1

Query: 609 TLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDY 451
           ++ G+  ++     +++E +K KI+ + GIP  +  L   GK L D + L+DY
Sbjct: 149 SMPGRLFSIGANKMESVEQLKMKIECQTGIPRTKFWLRLHGKPLYDDKKLADY 201


>U09415-1|AAA82164.1|  655|Caenorhabditis elegans Ceprp21 protein.
          Length = 655

 Score = 34.7 bits (76), Expect = 0.058
 Identities = 14/62 (22%), Positives = 34/62 (54%)
 Frame = -1

Query: 606 LTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQKESTL 427
           + G  +   ++ +  +  +K +IQD+ G+P  +Q+L   G  ++D  + + YN+   + +
Sbjct: 584 MDGSIVQFTIQVTAPMSELKQQIQDRYGMPVGKQKLMSDGLFVKDNMSSAFYNLADRTAI 643

Query: 426 HL 421
           +L
Sbjct: 644 YL 645


>AF106576-5|AAC78179.1|  655|Caenorhabditis elegans Yeast prp
           (splicing factor) relatedprotein 21 protein.
          Length = 655

 Score = 34.7 bits (76), Expect = 0.058
 Identities = 14/62 (22%), Positives = 34/62 (54%)
 Frame = -1

Query: 606 LTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQKESTL 427
           + G  +   ++ +  +  +K +IQD+ G+P  +Q+L   G  ++D  + + YN+   + +
Sbjct: 584 MDGSIVQFTIQVTAPMSELKQQIQDRYGMPVGKQKLMSDGLFVKDNMSSAFYNLADRTAI 643

Query: 426 HL 421
           +L
Sbjct: 644 YL 645


>Z69904-3|CAA93780.1|  372|Caenorhabditis elegans Hypothetical
           protein ZK20.3 protein.
          Length = 372

 Score = 33.5 bits (73), Expect = 0.13
 Identities = 18/54 (33%), Positives = 28/54 (51%), Gaps = 2/54 (3%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEG--IPPNQQRLXFAGKQLED 472
           + +  +TLT     LE+    TI  VKA +  ++G    P  Q+L + GK L+D
Sbjct: 52  LSVTFRTLTQVNFNLELNEDQTIAEVKALVASEKGDDYAPELQKLIYNGKILDD 105


>AF099917-6|AAC68780.1|  264|Caenorhabditis elegans Hypothetical
           protein F54D10.7 protein.
          Length = 264

 Score = 32.3 bits (70), Expect = 0.31
 Identities = 18/60 (30%), Positives = 31/60 (51%)
 Frame = -1

Query: 606 LTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQKESTL 427
           L G  I +E++  DTI  V   +    G+  ++QRL    K+L+  +TL +  I+  S +
Sbjct: 189 LHGSRIPMELDSLDTIYTVGMALLKHGGLALHRQRLMLNDKELQYNQTLEEAGIKDGSVI 248


>L16621-4|AAO12390.1| 1595|Caenorhabditis elegans Hypothetical
           protein ZK688.5b protein.
          Length = 1595

 Score = 30.7 bits (66), Expect = 0.94
 Identities = 18/70 (25%), Positives = 35/70 (50%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ +KTL  +  T+ +   DTI+++    + +  I    QR+   G+ L   +T+    
Sbjct: 21  IRVTLKTLDDREATVTIGLQDTIQSLIDLGRREMNIQSGFQRVIAGGRVLNSTQTVQAAG 80

Query: 447 IQKESTLHLV 418
           I    T+HLV
Sbjct: 81  ISDGQTVHLV 90


>L16621-3|AAL00883.1| 1620|Caenorhabditis elegans Hypothetical
           protein ZK688.5a protein.
          Length = 1620

 Score = 30.7 bits (66), Expect = 0.94
 Identities = 18/70 (25%), Positives = 35/70 (50%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ +KTL  +  T+ +   DTI+++    + +  I    QR+   G+ L   +T+    
Sbjct: 21  IRVTLKTLDDREATVTIGLQDTIQSLIDLGRREMNIQSGFQRVIAGGRVLNSTQTVQAAG 80

Query: 447 IQKESTLHLV 418
           I    T+HLV
Sbjct: 81  ISDGQTVHLV 90


>AF040645-10|AAB94971.2|  110|Caenorhabditis elegans Hypothetical
           protein F52C6.2 protein.
          Length = 110

 Score = 30.3 bits (65), Expect = 1.2
 Identities = 23/64 (35%), Positives = 34/64 (53%), Gaps = 1/64 (1%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQ-LEDGRTLSDY 451
           M + +KT TGKTIT+E   S     VK +++ K+G+         AG Q +E   T+ D 
Sbjct: 1   MLLSIKTSTGKTITVEAPKS-----VKTEVRYKQGVVFAVSYDKDAGNQIIEMEDTVQDV 55

Query: 450 NIQK 439
            IQ+
Sbjct: 56  KIQE 59


>Z92834-5|CAB07390.1|  402|Caenorhabditis elegans Hypothetical
           protein F39B2.10 protein.
          Length = 402

 Score = 28.7 bits (61), Expect = 3.8
 Identities = 12/33 (36%), Positives = 18/33 (54%)
 Frame = -1

Query: 615 VKTLTGKTITLEVEPSDTIENVKAKIQDKEGIP 517
           + TL G+TI   V P + I +   K+   EG+P
Sbjct: 279 ISTLDGRTIFYRVLPGEVIAHADVKVIHNEGMP 311


>Z93395-7|CAH04744.1| 2389|Caenorhabditis elegans Hypothetical protein
            ZC101.2f protein.
          Length = 2389

 Score = 28.3 bits (60), Expect = 5.0
 Identities = 12/27 (44%), Positives = 15/27 (55%)
 Frame = +3

Query: 414  STPGGGWIPSGYCSPXGYVHLPAAFQQ 494
            S PGG  +PSG     G +H+P A  Q
Sbjct: 1258 SRPGGAPLPSGVQEQQGILHIPRASDQ 1284


>Z93395-6|CAB07708.1| 3375|Caenorhabditis elegans Hypothetical protein
            ZC101.2e protein.
          Length = 3375

 Score = 28.3 bits (60), Expect = 5.0
 Identities = 12/27 (44%), Positives = 15/27 (55%)
 Frame = +3

Query: 414  STPGGGWIPSGYCSPXGYVHLPAAFQQ 494
            S PGG  +PSG     G +H+P A  Q
Sbjct: 1351 SRPGGAPLPSGVQEQQGILHIPRASDQ 1377


>Z93395-4|CAB07707.1| 2295|Caenorhabditis elegans Hypothetical protein
            ZC101.2c protein.
          Length = 2295

 Score = 28.3 bits (60), Expect = 5.0
 Identities = 12/27 (44%), Positives = 15/27 (55%)
 Frame = +3

Query: 414  STPGGGWIPSGYCSPXGYVHLPAAFQQ 494
            S PGG  +PSG     G +H+P A  Q
Sbjct: 1351 SRPGGAPLPSGVQEQQGILHIPRASDQ 1377


>Z93395-3|CAB07706.1| 2482|Caenorhabditis elegans Hypothetical protein
            ZC101.2a protein.
          Length = 2482

 Score = 28.3 bits (60), Expect = 5.0
 Identities = 12/27 (44%), Positives = 15/27 (55%)
 Frame = +3

Query: 414  STPGGGWIPSGYCSPXGYVHLPAAFQQ 494
            S PGG  +PSG     G +H+P A  Q
Sbjct: 1351 SRPGGAPLPSGVQEQQGILHIPRASDQ 1377


>Z93375-9|CAH04704.1| 2389|Caenorhabditis elegans Hypothetical protein
            ZC101.2f protein.
          Length = 2389

 Score = 28.3 bits (60), Expect = 5.0
 Identities = 12/27 (44%), Positives = 15/27 (55%)
 Frame = +3

Query: 414  STPGGGWIPSGYCSPXGYVHLPAAFQQ 494
            S PGG  +PSG     G +H+P A  Q
Sbjct: 1258 SRPGGAPLPSGVQEQQGILHIPRASDQ 1284


>Z93375-8|CAB07569.1| 3375|Caenorhabditis elegans Hypothetical protein
            ZC101.2e protein.
          Length = 3375

 Score = 28.3 bits (60), Expect = 5.0
 Identities = 12/27 (44%), Positives = 15/27 (55%)
 Frame = +3

Query: 414  STPGGGWIPSGYCSPXGYVHLPAAFQQ 494
            S PGG  +PSG     G +H+P A  Q
Sbjct: 1351 SRPGGAPLPSGVQEQQGILHIPRASDQ 1377


>Z93375-7|CAB07568.1| 2295|Caenorhabditis elegans Hypothetical protein
            ZC101.2c protein.
          Length = 2295

 Score = 28.3 bits (60), Expect = 5.0
 Identities = 12/27 (44%), Positives = 15/27 (55%)
 Frame = +3

Query: 414  STPGGGWIPSGYCSPXGYVHLPAAFQQ 494
            S PGG  +PSG     G +H+P A  Q
Sbjct: 1351 SRPGGAPLPSGVQEQQGILHIPRASDQ 1377


>Z93375-6|CAB07567.1| 2482|Caenorhabditis elegans Hypothetical protein
            ZC101.2a protein.
          Length = 2482

 Score = 28.3 bits (60), Expect = 5.0
 Identities = 12/27 (44%), Positives = 15/27 (55%)
 Frame = +3

Query: 414  STPGGGWIPSGYCSPXGYVHLPAAFQQ 494
            S PGG  +PSG     G +H+P A  Q
Sbjct: 1351 SRPGGAPLPSGVQEQQGILHIPRASDQ 1377


>L13458-1|AAA28156.1| 2481|Caenorhabditis elegans basement membrane
            proteoglycan protein.
          Length = 2481

 Score = 28.3 bits (60), Expect = 5.0
 Identities = 12/27 (44%), Positives = 15/27 (55%)
 Frame = +3

Query: 414  STPGGGWIPSGYCSPXGYVHLPAAFQQ 494
            S PGG  +PSG     G +H+P A  Q
Sbjct: 1350 SRPGGAPLPSGVQEQQGILHIPRASDQ 1376


>U80452-5|AAB37859.1|  180|Caenorhabditis elegans Hypothetical
           protein C16C8.5 protein.
          Length = 180

 Score = 27.5 bits (58), Expect = 8.8
 Identities = 9/27 (33%), Positives = 18/27 (66%)
 Frame = -1

Query: 501 LXFAGKQLEDGRTLSDYNIQKESTLHL 421
           L + G++L+D R++  YNI +   ++L
Sbjct: 129 LYYGGQKLQDNRSIGSYNIDQSREIYL 155


>U28735-6|AAF99954.1| 1493|Caenorhabditis elegans Hypothetical protein
            F48E3.3 protein.
          Length = 1493

 Score = 27.5 bits (58), Expect = 8.8
 Identities = 10/36 (27%), Positives = 21/36 (58%)
 Frame = -1

Query: 627  MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGI 520
            +Q+ + + TGK++ + VE  + +E       D+EG+
Sbjct: 1149 LQVVIDSFTGKSVRVRVEKREGMEERNLLSDDEEGV 1184


>AF003130-4|AAB54126.1| 1043|Caenorhabditis elegans Hypothetical
           protein F55A12.8 protein.
          Length = 1043

 Score = 27.5 bits (58), Expect = 8.8
 Identities = 11/33 (33%), Positives = 21/33 (63%)
 Frame = -1

Query: 597 KTITLEVEPSDTIENVKAKIQDKEGIPPNQQRL 499
           KT+  +V+   T+E ++ +I+ +  +PP  QRL
Sbjct: 664 KTVIKQVKDGHTVELLEERIEPRADLPPLLQRL 696


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,007,250
Number of Sequences: 27780
Number of extensions: 227647
Number of successful extensions: 665
Number of sequences better than 10.0: 38
Number of HSP's better than 10.0 without gapping: 580
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 662
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1455289764
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -