SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B05
         (653 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z68751-1|CAA92971.1|  210|Caenorhabditis elegans Hypothetical pr...   297   6e-81
Z72503-6|CAA96594.4|  273|Caenorhabditis elegans Hypothetical pr...    30   1.2  
Z79604-3|CAD36502.1|  817|Caenorhabditis elegans Hypothetical pr...    29   2.2  
Z79604-2|CAB01900.1|  780|Caenorhabditis elegans Hypothetical pr...    29   2.2  
AF332205-1|AAK17976.1|  817|Caenorhabditis elegans nuclear recep...    29   2.2  
AF332204-1|AAK17975.1|  519|Caenorhabditis elegans nuclear recep...    29   2.2  

>Z68751-1|CAA92971.1|  210|Caenorhabditis elegans Hypothetical
           protein T05E11.1 protein.
          Length = 210

 Score =  297 bits (728), Expect = 6e-81
 Identities = 140/168 (83%), Positives = 152/168 (90%)
 Frame = +2

Query: 149 AADIPEIKLFGRWSCYDVQVSDMSLQDYISVKEKYAKYLPHSAGRYAHKRFRKAQCPIVE 328
           A + PE+ LFG+WS   V VSD+SL DYI VKEK AKYLPHSAGR+  +RFRKA CPIVE
Sbjct: 17  ATEAPEVALFGKWSLQSVNVSDISLVDYIPVKEKSAKYLPHSAGRFQVRRFRKAACPIVE 76

Query: 329 RLTNSLMMHGRNNGKKLMAVRIVKHAFEIIHLLTGENPLQVLVTAIINSGPREDSTRIGR 508
           RL NSLMMHGRNNGKKLM VRIVKHAFEII+LLTGENP+QVLV A+INSGPREDSTRIGR
Sbjct: 77  RLANSLMMHGRNNGKKLMTVRIVKHAFEIIYLLTGENPVQVLVNAVINSGPREDSTRIGR 136

Query: 509 AGTVRRQAVDVSPLRRVNQAIWLLCTGAREAAFRNIKTIAECVADELI 652
           AGTVRRQAVDV+PLRRVNQAIWLLCTGAREAAFRN+KTIAEC+ADELI
Sbjct: 137 AGTVRRQAVDVAPLRRVNQAIWLLCTGAREAAFRNVKTIAECLADELI 184


>Z72503-6|CAA96594.4|  273|Caenorhabditis elegans Hypothetical
           protein C26C6.8 protein.
          Length = 273

 Score = 30.3 bits (65), Expect = 1.2
 Identities = 18/58 (31%), Positives = 29/58 (50%)
 Frame = +3

Query: 468 STLDPVKIRLGSVVRVQFVVKPLMFHPCAESTKQSGFCAQVHVRLHSEILKQSQSVLQ 641
           S  D + ++ G  V V  +  P   +    S  QSGF    HV++  EIL+Q+  V++
Sbjct: 149 SAPDDISVKDGESVTVLNISDPEWTY-IRNSDNQSGFVPSSHVKIPHEILQQASRVIK 205


>Z79604-3|CAD36502.1|  817|Caenorhabditis elegans Hypothetical
           protein ZK662.3b protein.
          Length = 817

 Score = 29.5 bits (63), Expect = 2.2
 Identities = 13/39 (33%), Positives = 21/39 (53%), Gaps = 2/39 (5%)
 Frame = -2

Query: 610 SECSLTCTCAQKP--DCLVDSAQG*NINGLTTNCTRTTD 500
           S C+ +C C + P   C+VD      +NG ++N +  TD
Sbjct: 493 STCTCSCMCGRYPPGSCIVDEVTKDLLNGGSSNSSNATD 531


>Z79604-2|CAB01900.1|  780|Caenorhabditis elegans Hypothetical
           protein ZK662.3a protein.
          Length = 780

 Score = 29.5 bits (63), Expect = 2.2
 Identities = 13/39 (33%), Positives = 21/39 (53%), Gaps = 2/39 (5%)
 Frame = -2

Query: 610 SECSLTCTCAQKP--DCLVDSAQG*NINGLTTNCTRTTD 500
           S C+ +C C + P   C+VD      +NG ++N +  TD
Sbjct: 456 STCTCSCMCGRYPPGSCIVDEVTKDLLNGGSSNSSNATD 494


>AF332205-1|AAK17976.1|  817|Caenorhabditis elegans nuclear receptor
           NHR-48 protein.
          Length = 817

 Score = 29.5 bits (63), Expect = 2.2
 Identities = 13/39 (33%), Positives = 21/39 (53%), Gaps = 2/39 (5%)
 Frame = -2

Query: 610 SECSLTCTCAQKP--DCLVDSAQG*NINGLTTNCTRTTD 500
           S C+ +C C + P   C+VD      +NG ++N +  TD
Sbjct: 493 STCTCSCMCGRYPPGSCIVDEVTKDLLNGGSSNSSNATD 531


>AF332204-1|AAK17975.1|  519|Caenorhabditis elegans nuclear receptor
           NHR-48 protein.
          Length = 519

 Score = 29.5 bits (63), Expect = 2.2
 Identities = 13/39 (33%), Positives = 21/39 (53%), Gaps = 2/39 (5%)
 Frame = -2

Query: 610 SECSLTCTCAQKP--DCLVDSAQG*NINGLTTNCTRTTD 500
           S C+ +C C + P   C+VD      +NG ++N +  TD
Sbjct: 195 STCTCSCMCGRYPPGSCIVDEVTKDLLNGGSSNSSNATD 233


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,403,371
Number of Sequences: 27780
Number of extensions: 329709
Number of successful extensions: 878
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 823
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 878
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1455289764
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -