SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B03
         (549 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

L15188-7|AAA27951.1|  161|Caenorhabditis elegans Ribosomal prote...   166   1e-41
AC084197-45|AAK68589.4|  751|Caenorhabditis elegans Hypothetical...    30   0.95 
U00047-4|AAA50690.1|  825|Caenorhabditis elegans Hypothetical pr...    29   1.7  
AL132853-5|CAB60443.1|  279|Caenorhabditis elegans Hypothetical ...    29   2.2  
Z46267-9|CAA86427.2|  889|Caenorhabditis elegans Hypothetical pr...    29   2.9  
Z92775-2|CAB07162.2|  382|Caenorhabditis elegans Hypothetical pr...    28   3.9  
Z92775-1|CAB07161.2|  379|Caenorhabditis elegans Hypothetical pr...    28   3.9  
Z78016-1|CAB01439.1|  276|Caenorhabditis elegans Hypothetical pr...    28   3.9  
Z81491-1|CAB04019.1|  181|Caenorhabditis elegans Hypothetical pr...    28   5.1  
U64859-9|AAC69090.1|  378|Caenorhabditis elegans Activated in bl...    28   5.1  
U64859-8|AAC69096.1|  378|Caenorhabditis elegans Prion-like-(q/n...    28   5.1  
AF038605-2|AAB92020.1|  698|Caenorhabditis elegans Hypothetical ...    28   5.1  
Z71177-9|CAA94868.2|  425|Caenorhabditis elegans Hypothetical pr...    27   6.7  
Z71177-2|CAA94867.1|  425|Caenorhabditis elegans Hypothetical pr...    27   6.7  
Z81035-1|CAB02735.1|  221|Caenorhabditis elegans Hypothetical pr...    27   8.9  
AL110490-7|CAD59175.1|  533|Caenorhabditis elegans Hypothetical ...    27   8.9  
AL110490-6|CAB54442.2|  687|Caenorhabditis elegans Hypothetical ...    27   8.9  
AF016451-13|AAB66007.1|  445|Caenorhabditis elegans Activated in...    27   8.9  
AF016451-5|AAB65995.1|  438|Caenorhabditis elegans Activated in ...    27   8.9  
AF016451-4|AAB65996.1|  388|Caenorhabditis elegans Activated in ...    27   8.9  
AF016451-3|AAB66001.1|  388|Caenorhabditis elegans Prion-like-(q...    27   8.9  

>L15188-7|AAA27951.1|  161|Caenorhabditis elegans Ribosomal protein,
           large subunitprotein 21 protein.
          Length = 161

 Score =  166 bits (403), Expect = 1e-41
 Identities = 79/132 (59%), Positives = 98/132 (74%), Gaps = 2/132 (1%)
 Frame = +2

Query: 125 YMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVNKRVRGRIIPKRI 304
           Y   YK GD+VDI+ NGA QKGMP K YHG+TGR++NVT  A+G+IVNKRVRG I+PKRI
Sbjct: 30  YYTQYKRGDLVDIKTNGAFQKGMPFKAYHGRTGRIFNVTRGAVGIIVNKRVRGNILPKRI 89

Query: 305 NIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTV-NLKRQPAPPKAAH-IVSGTEKP 478
           NIR+EH+K SKCR DFL RVK N+   K AK+AG+ V  LKR P  P+ AH + +   +P
Sbjct: 90  NIRIEHIKPSKCRTDFLNRVKSNDEKRKAAKSAGQPVPALKRLPVAPRGAHTVTTQNNEP 149

Query: 479 VLLAPIPYEFVA 514
            LLAP+ +E VA
Sbjct: 150 ELLAPLRFEIVA 161



 Score = 27.1 bits (57), Expect = 8.9
 Identities = 11/14 (78%), Positives = 12/14 (85%)
 Frame = +3

Query: 36 MTNSKGYRRGTRXL 77
          MTNSKG RRGTR +
Sbjct: 1  MTNSKGLRRGTRYM 14


>AC084197-45|AAK68589.4|  751|Caenorhabditis elegans Hypothetical
           protein Y73B6BL.1 protein.
          Length = 751

 Score = 30.3 bits (65), Expect = 0.95
 Identities = 16/46 (34%), Positives = 20/46 (43%)
 Frame = +1

Query: 139 QSWRHCRHQRQWCSSKGYATQSIPWKDRSRVQRDCSCSRCDCQQAC 276
           Q  RHC  Q   C S  Y      W+ RSRV    +C+  +  Q C
Sbjct: 366 QPVRHCSEQDATCDSPFYWCDMKLWRCRSRVVYGGNCTGYEGTQIC 411


>U00047-4|AAA50690.1|  825|Caenorhabditis elegans Hypothetical
           protein ZK418.6 protein.
          Length = 825

 Score = 29.5 bits (63), Expect = 1.7
 Identities = 11/19 (57%), Positives = 14/19 (73%)
 Frame = +2

Query: 416 NLKRQPAPPKAAHIVSGTE 472
           NL+R+PAPPK  H+ S  E
Sbjct: 462 NLRRRPAPPKQNHVASPAE 480


>AL132853-5|CAB60443.1|  279|Caenorhabditis elegans Hypothetical
           protein Y80D3A.9 protein.
          Length = 279

 Score = 29.1 bits (62), Expect = 2.2
 Identities = 12/29 (41%), Positives = 15/29 (51%)
 Frame = -3

Query: 481 DGFLSSTDDVGSFRGSWLSLQVDGLAGSL 395
           DG LS  D+    RG+WL +   G  G L
Sbjct: 39  DGMLSGVDEKDVARGTWLGMDAHGKVGML 67


>Z46267-9|CAA86427.2|  889|Caenorhabditis elegans Hypothetical
           protein F49E2.5d protein.
          Length = 889

 Score = 28.7 bits (61), Expect = 2.9
 Identities = 18/62 (29%), Positives = 32/62 (51%), Gaps = 1/62 (1%)
 Frame = +2

Query: 314 VEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVN-LKRQPAPPKAAHIVSGTEKPVLLA 490
           VE+V          +  K+N++  K++++   T   ++  PAPP+   +V   EKPV  A
Sbjct: 361 VENVVEKSTTPPATENKKKNKKDKKKSESEKVTEQPVESAPAPPQVEQVVEKVEKPV--A 418

Query: 491 PI 496
           P+
Sbjct: 419 PV 420


>Z92775-2|CAB07162.2|  382|Caenorhabditis elegans Hypothetical
           protein C06H5.2 protein.
          Length = 382

 Score = 28.3 bits (60), Expect = 3.9
 Identities = 18/52 (34%), Positives = 28/52 (53%)
 Frame = -3

Query: 376 LILFDSLKEVLSALGVLDMLNTDIDALRYNPSANTLVDNHTESMSSHVVHAT 221
           LILFD+LK VL ++GVL   +  I+ L     A  L   +TE +    + ++
Sbjct: 200 LILFDALKNVLQSVGVLTTKSVLINWLPSVQIAEILEHFNTEILEDLTIKSS 251


>Z92775-1|CAB07161.2|  379|Caenorhabditis elegans Hypothetical
           protein C06H5.1 protein.
          Length = 379

 Score = 28.3 bits (60), Expect = 3.9
 Identities = 18/52 (34%), Positives = 28/52 (53%)
 Frame = -3

Query: 376 LILFDSLKEVLSALGVLDMLNTDIDALRYNPSANTLVDNHTESMSSHVVHAT 221
           LILFD+LK VL ++GVL   +  I+ L     A  L   +TE +    + ++
Sbjct: 200 LILFDALKNVLQSVGVLTTKSVLINWLPSVQIAEILEHFNTEILEDLTIKSS 251


>Z78016-1|CAB01439.1|  276|Caenorhabditis elegans Hypothetical
           protein R186.1 protein.
          Length = 276

 Score = 28.3 bits (60), Expect = 3.9
 Identities = 12/29 (41%), Positives = 16/29 (55%)
 Frame = -3

Query: 481 DGFLSSTDDVGSFRGSWLSLQVDGLAGSL 395
           DG LS  D   + RG+WL L  +G  G +
Sbjct: 39  DGILSGVDKQENARGTWLGLNENGRIGMM 67


>Z81491-1|CAB04019.1|  181|Caenorhabditis elegans Hypothetical
           protein D1086.1 protein.
          Length = 181

 Score = 27.9 bits (59), Expect = 5.1
 Identities = 11/37 (29%), Positives = 21/37 (56%), Gaps = 2/37 (5%)
 Frame = +1

Query: 196 TQSIPW--KDRSRVQRDCSCSRCDCQQACSRKDYTEA 300
           T+ + W   D+SR+  D  C++   ++ C  KD+ +A
Sbjct: 120 TECVQWYFSDKSRMSTDQKCAQFKAKKQCIEKDFGKA 156


>U64859-9|AAC69090.1|  378|Caenorhabditis elegans Activated in
           blocked unfolded proteinresponse protein 9 protein.
          Length = 378

 Score = 27.9 bits (59), Expect = 5.1
 Identities = 20/68 (29%), Positives = 25/68 (36%)
 Frame = +1

Query: 232 QRDCSCSRCDCQQACSRKDYTEAHQYPC*ACQALQVQTRLP*ESQRE*EATEGSQGCRQD 411
           Q  CSC +    Q+CS +      Q P  +C   Q Q     + Q    A    Q CRQ 
Sbjct: 34  QSQCSCQQVQQTQSCSCQSAPVQQQAP--SCSCAQPQQTQTVQVQSTQCAPACQQSCRQQ 91

Query: 412 RQPEETAS 435
            Q     S
Sbjct: 92  CQSAPAVS 99


>U64859-8|AAC69096.1|  378|Caenorhabditis elegans
           Prion-like-(q/n-rich)-domain-bearingprotein protein 57
           protein.
          Length = 378

 Score = 27.9 bits (59), Expect = 5.1
 Identities = 20/68 (29%), Positives = 25/68 (36%)
 Frame = +1

Query: 232 QRDCSCSRCDCQQACSRKDYTEAHQYPC*ACQALQVQTRLP*ESQRE*EATEGSQGCRQD 411
           Q  CSC +    Q+CS +      Q P  +C   Q Q     + Q    A    Q CRQ 
Sbjct: 34  QSQCSCQQVQQTQSCSCQSAPVQQQAP--SCSCAQPQQTQTVQVQSTQCAPACQQSCRQQ 91

Query: 412 RQPEETAS 435
            Q     S
Sbjct: 92  CQSAPAVS 99


>AF038605-2|AAB92020.1|  698|Caenorhabditis elegans Hypothetical
           protein C02B10.5 protein.
          Length = 698

 Score = 27.9 bits (59), Expect = 5.1
 Identities = 18/68 (26%), Positives = 28/68 (41%)
 Frame = +2

Query: 44  LQGLPPRHQGTCSLAGSAHMELFRSPRYMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTG 223
           +QG+PP H G   + G  H    + P+   +   G+        A Q G PH    G   
Sbjct: 615 MQGMPPMHPGMQGMPGMPHGPP-QPPQNPALMVAGNRAGSAEAAAAQMGNPHHPMMG--A 671

Query: 224 RVYNVTAH 247
            ++ +T H
Sbjct: 672 NMWQLTPH 679


>Z71177-9|CAA94868.2|  425|Caenorhabditis elegans Hypothetical
           protein AC3.4 protein.
          Length = 425

 Score = 27.5 bits (58), Expect = 6.7
 Identities = 12/33 (36%), Positives = 18/33 (54%), Gaps = 1/33 (3%)
 Frame = +1

Query: 232 QRDCSCS-RCDCQQACSRKDYTEAHQYPC*ACQ 327
           ++ C C+ R     +C R  YT+  QY C +CQ
Sbjct: 26  RQSCGCAPRVQPSCSCQRTTYTQPQQYSC-SCQ 57


>Z71177-2|CAA94867.1|  425|Caenorhabditis elegans Hypothetical
           protein AC3.3 protein.
          Length = 425

 Score = 27.5 bits (58), Expect = 6.7
 Identities = 12/33 (36%), Positives = 18/33 (54%), Gaps = 1/33 (3%)
 Frame = +1

Query: 232 QRDCSCS-RCDCQQACSRKDYTEAHQYPC*ACQ 327
           ++ C C+ R     +C R  YT+  QY C +CQ
Sbjct: 26  RQSCGCAPRVQPSCSCQRTTYTQPQQYSC-SCQ 57


>Z81035-1|CAB02735.1|  221|Caenorhabditis elegans Hypothetical
           protein C15H11.1 protein.
          Length = 221

 Score = 27.1 bits (57), Expect = 8.9
 Identities = 16/51 (31%), Positives = 26/51 (50%), Gaps = 1/51 (1%)
 Frame = +1

Query: 112 PLSTXHESV-QSWRHCRHQRQWCSSKGYATQSIPWKDRSRVQRDCSCSRCD 261
           P  T   S+ QS +H R +RQ  S++  +T++I     S  Q++C     D
Sbjct: 134 PTPTVASSIKQSTKHKRTERQLQSTQKMSTENITSVQASTTQQECPTQEDD 184


>AL110490-7|CAD59175.1|  533|Caenorhabditis elegans Hypothetical
           protein Y48B6A.6b protein.
          Length = 533

 Score = 27.1 bits (57), Expect = 8.9
 Identities = 16/72 (22%), Positives = 29/72 (40%)
 Frame = +2

Query: 290 IPKRINIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKAAHIVSGT 469
           +P     R+  V+  +  ++  +R KE+E      +   + + + R P PP    I    
Sbjct: 207 LPPTPPARITSVRSDESIEEEERRRKESEETASFEELEAEIMRISRSPVPPPVLSIPPPP 266

Query: 470 EKPVLLAPIPYE 505
              + L  IP E
Sbjct: 267 PPNIPLPTIPQE 278


>AL110490-6|CAB54442.2|  687|Caenorhabditis elegans Hypothetical
           protein Y48B6A.6a protein.
          Length = 687

 Score = 27.1 bits (57), Expect = 8.9
 Identities = 16/72 (22%), Positives = 29/72 (40%)
 Frame = +2

Query: 290 IPKRINIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKAAHIVSGT 469
           +P     R+  V+  +  ++  +R KE+E      +   + + + R P PP    I    
Sbjct: 207 LPPTPPARITSVRSDESIEEEERRRKESEETASFEELEAEIMRISRSPVPPPVLSIPPPP 266

Query: 470 EKPVLLAPIPYE 505
              + L  IP E
Sbjct: 267 PPNIPLPTIPQE 278


>AF016451-13|AAB66007.1|  445|Caenorhabditis elegans Activated in
           blocked unfolded proteinresponse protein 8 protein.
          Length = 445

 Score = 27.1 bits (57), Expect = 8.9
 Identities = 20/68 (29%), Positives = 32/68 (47%)
 Frame = +1

Query: 232 QRDCSCSRCDCQQACSRKDYTEAHQYPC*ACQALQVQTRLP*ESQRE*EATEGSQGCRQD 411
           Q  CSC +    Q+CS +      Q P  +C   Q QT+     Q + ++T+ +  C+Q 
Sbjct: 35  QSQCSCQQVQQTQSCSCQSAPVQQQSPSCSCAQPQ-QTQ-----QVQVQSTQCAPACQQS 88

Query: 412 RQPEETAS 435
            Q +  AS
Sbjct: 89  CQQQCQAS 96


>AF016451-5|AAB65995.1|  438|Caenorhabditis elegans Activated in
           blocked unfolded proteinresponse protein 7 protein.
          Length = 438

 Score = 27.1 bits (57), Expect = 8.9
 Identities = 20/68 (29%), Positives = 32/68 (47%)
 Frame = +1

Query: 232 QRDCSCSRCDCQQACSRKDYTEAHQYPC*ACQALQVQTRLP*ESQRE*EATEGSQGCRQD 411
           Q  CSC +    Q+CS +      Q P  +C   Q QT+     Q + ++T+ +  C+Q 
Sbjct: 35  QSQCSCQQVQQTQSCSCQSAPVQQQSPSCSCAQPQ-QTQ-----QVQVQSTQCAPACQQS 88

Query: 412 RQPEETAS 435
            Q +  AS
Sbjct: 89  CQQQCQAS 96


>AF016451-4|AAB65996.1|  388|Caenorhabditis elegans Activated in
           blocked unfolded proteinresponse protein 6 protein.
          Length = 388

 Score = 27.1 bits (57), Expect = 8.9
 Identities = 20/68 (29%), Positives = 32/68 (47%)
 Frame = +1

Query: 232 QRDCSCSRCDCQQACSRKDYTEAHQYPC*ACQALQVQTRLP*ESQRE*EATEGSQGCRQD 411
           Q  CSC +    Q+CS +      Q P  +C   Q QT+     Q + ++T+ +  C+Q 
Sbjct: 35  QSQCSCQQVQQTQSCSCQSAPVQQQSPSCSCAQPQ-QTQ-----QVQVQSTQCAPACQQS 88

Query: 412 RQPEETAS 435
            Q +  AS
Sbjct: 89  CQQQCQAS 96


>AF016451-3|AAB66001.1|  388|Caenorhabditis elegans
           Prion-like-(q/n-rich)-domain-bearingprotein protein 5
           protein.
          Length = 388

 Score = 27.1 bits (57), Expect = 8.9
 Identities = 20/68 (29%), Positives = 32/68 (47%)
 Frame = +1

Query: 232 QRDCSCSRCDCQQACSRKDYTEAHQYPC*ACQALQVQTRLP*ESQRE*EATEGSQGCRQD 411
           Q  CSC +    Q+CS +      Q P  +C   Q QT+     Q + ++T+ +  C+Q 
Sbjct: 35  QSQCSCQQVQQTQSCSCQSAPVQQQSPSCSCAQPQ-QTQ-----QVQVQSTQCAPACQQS 88

Query: 412 RQPEETAS 435
            Q +  AS
Sbjct: 89  CQQQCQAS 96


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,377,061
Number of Sequences: 27780
Number of extensions: 256530
Number of successful extensions: 917
Number of sequences better than 10.0: 21
Number of HSP's better than 10.0 without gapping: 868
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 916
length of database: 12,740,198
effective HSP length: 77
effective length of database: 10,601,138
effective search space used: 1113119490
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -