SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B02
         (347 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U80953-1|AAB52557.2|   56|Caenorhabditis elegans Ribosomal prote...    70   5e-13
Z72504-3|CAA96605.1|  449|Caenorhabditis elegans Hypothetical pr...    31   0.23 
AF273784-1|AAG15133.1|  459|Caenorhabditis elegans nuclear recep...    31   0.23 
Z74040-6|CAA98509.2|  457|Caenorhabditis elegans Hypothetical pr...    29   0.69 
AF022985-15|AAB69969.2|  435|Caenorhabditis elegans Hypothetical...    28   1.6  
AL009246-7|CAA15840.2|  347|Caenorhabditis elegans Hypothetical ...    28   2.1  
Z83102-11|CAB05470.1|  310|Caenorhabditis elegans Hypothetical p...    27   4.9  
Z81492-11|CAB04035.1|  310|Caenorhabditis elegans Hypothetical p...    27   4.9  
AL132876-23|CAD92403.1|  210|Caenorhabditis elegans Hypothetical...    27   4.9  
Z71185-3|CAA94905.2|  427|Caenorhabditis elegans Hypothetical pr...    26   6.4  
AL132858-16|CAB60486.2|  538|Caenorhabditis elegans Hypothetical...    26   6.4  
AL117207-25|CAB61042.2|  538|Caenorhabditis elegans Hypothetical...    26   6.4  
Z83114-4|CAB05554.4|  739|Caenorhabditis elegans Hypothetical pr...    26   8.5  
AF026214-7|AAP68943.1|  640|Caenorhabditis elegans Hypothetical ...    26   8.5  

>U80953-1|AAB52557.2|   56|Caenorhabditis elegans Ribosomal protein,
           small subunitprotein 29 protein.
          Length = 56

 Score = 69.7 bits (163), Expect = 5e-13
 Identities = 28/37 (75%), Positives = 32/37 (86%)
 Frame = +2

Query: 140 SCRSCSNRHGLIRKYGLNICRQCFREYAHDIGFKKLD 250
           SCR C+  HGLIRKYGL++CR+CFRE A DIGFKKLD
Sbjct: 20  SCRVCAGHHGLIRKYGLDLCRRCFREQARDIGFKKLD 56



 Score = 36.3 bits (80), Expect = 0.006
 Identities = 12/19 (63%), Positives = 16/19 (84%)
 Frame = +1

Query: 82  MGHANIWYSHPRRYGQGSR 138
           MG  N+W+SHPR++G GSR
Sbjct: 1   MGFQNLWFSHPRKFGPGSR 19


>Z72504-3|CAA96605.1|  449|Caenorhabditis elegans Hypothetical
           protein C29E6.5 protein.
          Length = 449

 Score = 31.1 bits (67), Expect = 0.23
 Identities = 11/34 (32%), Positives = 18/34 (52%)
 Frame = +2

Query: 143 CRSCSNRHGLIRKYGLNICRQCFREYAHDIGFKK 244
           CR C  R+   + +G++ICR C   +   +  KK
Sbjct: 47  CRVCERRYDGSQHFGIDICRACAAFFRRSVAVKK 80


>AF273784-1|AAG15133.1|  459|Caenorhabditis elegans nuclear receptor
           NHR-43 protein.
          Length = 459

 Score = 31.1 bits (67), Expect = 0.23
 Identities = 11/34 (32%), Positives = 18/34 (52%)
 Frame = +2

Query: 143 CRSCSNRHGLIRKYGLNICRQCFREYAHDIGFKK 244
           CR C  R+   + +G++ICR C   +   +  KK
Sbjct: 57  CRVCERRYDGSQHFGIDICRACAAFFRRSVAVKK 90


>Z74040-6|CAA98509.2|  457|Caenorhabditis elegans Hypothetical
           protein K10D6.1 protein.
          Length = 457

 Score = 29.5 bits (63), Expect = 0.69
 Identities = 10/34 (29%), Positives = 20/34 (58%)
 Frame = +1

Query: 142 MPILLQQAWLNPQVRFEHMQTVLQRVCS*HRIQE 243
           M I + + WL+P ++F+H+    Q +   H++ E
Sbjct: 101 MDIYINEMWLDPALKFDHLNPCKQNLSVSHQVLE 134


>AF022985-15|AAB69969.2|  435|Caenorhabditis elegans Hypothetical
           protein T15B7.16 protein.
          Length = 435

 Score = 28.3 bits (60), Expect = 1.6
 Identities = 9/26 (34%), Positives = 17/26 (65%)
 Frame = +1

Query: 142 MPILLQQAWLNPQVRFEHMQTVLQRV 219
           + +L  Q W +P++RF+H+   LQ +
Sbjct: 80  LDLLFSQIWHDPRLRFDHLTNCLQNL 105


>AL009246-7|CAA15840.2|  347|Caenorhabditis elegans Hypothetical
           protein C47F8.8 protein.
          Length = 347

 Score = 27.9 bits (59), Expect = 2.1
 Identities = 12/40 (30%), Positives = 18/40 (45%)
 Frame = +2

Query: 128 KDLGSCRSCSNRHGLIRKYGLNICRQCFREYAHDIGFKKL 247
           K+ G C+ C N     R +G+  C  C   +   IG + L
Sbjct: 6   KNRGPCQVCHNTETTRRHFGIISCTACAAFFRRSIGMQYL 45


>Z83102-11|CAB05470.1|  310|Caenorhabditis elegans Hypothetical
           protein E03H4.13 protein.
          Length = 310

 Score = 26.6 bits (56), Expect = 4.9
 Identities = 10/35 (28%), Positives = 15/35 (42%)
 Frame = +2

Query: 137 GSCRSCSNRHGLIRKYGLNICRQCFREYAHDIGFK 241
           G CR C +  G  R +G+  C  C   +   +  K
Sbjct: 6   GPCRVCHSVKGTRRHFGITACMSCSSFFRRSLNCK 40


>Z81492-11|CAB04035.1|  310|Caenorhabditis elegans Hypothetical
           protein E03H4.13 protein.
          Length = 310

 Score = 26.6 bits (56), Expect = 4.9
 Identities = 10/35 (28%), Positives = 15/35 (42%)
 Frame = +2

Query: 137 GSCRSCSNRHGLIRKYGLNICRQCFREYAHDIGFK 241
           G CR C +  G  R +G+  C  C   +   +  K
Sbjct: 6   GPCRVCHSVKGTRRHFGITACMSCSSFFRRSLNCK 40


>AL132876-23|CAD92403.1|  210|Caenorhabditis elegans Hypothetical
           protein Y105E8A.28 protein.
          Length = 210

 Score = 26.6 bits (56), Expect = 4.9
 Identities = 10/22 (45%), Positives = 14/22 (63%)
 Frame = +3

Query: 84  GPRKYLVFSPSQIRTRISXHAD 149
           GPR+ L+F P+Q   R+  H D
Sbjct: 74  GPRRRLLFQPNQRLCRVGEHRD 95


>Z71185-3|CAA94905.2|  427|Caenorhabditis elegans Hypothetical
           protein C35A5.4 protein.
          Length = 427

 Score = 26.2 bits (55), Expect = 6.4
 Identities = 11/34 (32%), Positives = 22/34 (64%), Gaps = 1/34 (2%)
 Frame = -3

Query: 138 PRSLSVSARVRIPN-ICVAHFKKLNCCFANEQQN 40
           PR  SV+A +R+PN +C+  + +    ++ E+Q+
Sbjct: 113 PRQTSVNAAIRMPNSVCIQVYHRPYNAYSAERQS 146


>AL132858-16|CAB60486.2|  538|Caenorhabditis elegans Hypothetical
           protein Y113G7A.5 protein.
          Length = 538

 Score = 26.2 bits (55), Expect = 6.4
 Identities = 11/23 (47%), Positives = 13/23 (56%)
 Frame = +1

Query: 127 QGSRXMPILLQQAWLNPQVRFEH 195
           Q S  M IL  Q W +P + FEH
Sbjct: 128 QSSSTMHILFSQIWHDPGLSFEH 150


>AL117207-25|CAB61042.2|  538|Caenorhabditis elegans Hypothetical
           protein Y113G7A.5 protein.
          Length = 538

 Score = 26.2 bits (55), Expect = 6.4
 Identities = 11/23 (47%), Positives = 13/23 (56%)
 Frame = +1

Query: 127 QGSRXMPILLQQAWLNPQVRFEH 195
           Q S  M IL  Q W +P + FEH
Sbjct: 128 QSSSTMHILFSQIWHDPGLSFEH 150


>Z83114-4|CAB05554.4|  739|Caenorhabditis elegans Hypothetical
           protein K09B11.10 protein.
          Length = 739

 Score = 25.8 bits (54), Expect = 8.5
 Identities = 13/31 (41%), Positives = 15/31 (48%)
 Frame = -1

Query: 218 TL*STVCICSNRTCGLSHACWSRIGMXRDPC 126
           TL S V  CS RT  LS   W + G   + C
Sbjct: 321 TLTSQVIPCSQRTTSLSLKYWMKTGTQAEIC 351


>AF026214-7|AAP68943.1|  640|Caenorhabditis elegans Hypothetical
           protein F52H2.1 protein.
          Length = 640

 Score = 25.8 bits (54), Expect = 8.5
 Identities = 11/31 (35%), Positives = 13/31 (41%)
 Frame = +2

Query: 137 GSCRSCSNRHGLIRKYGLNICRQCFREYAHD 229
           G    C     L    G+NI R CF  Y H+
Sbjct: 159 GQHEQCVGYAKLFLNLGVNIVRVCFGHYGHE 189


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 5,925,935
Number of Sequences: 27780
Number of extensions: 109517
Number of successful extensions: 265
Number of sequences better than 10.0: 14
Number of HSP's better than 10.0 without gapping: 257
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 265
length of database: 12,740,198
effective HSP length: 72
effective length of database: 10,740,038
effective search space used: 461821634
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -