SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A24
         (653 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z98866-6|CAB11546.1|  136|Caenorhabditis elegans Hypothetical pr...   109   1e-24
U28732-2|AAB04902.1|  136|Caenorhabditis elegans Histone protein...   109   1e-24
Z74476-1|CAA98963.1|  136|Caenorhabditis elegans Hypothetical pr...   109   2e-24
Z93388-9|CAB07653.1|  136|Caenorhabditis elegans Hypothetical pr...   100   1e-21
Z83245-7|CAB05834.1|  136|Caenorhabditis elegans Hypothetical pr...   100   1e-21
Z83245-3|CAB05833.1|  136|Caenorhabditis elegans Hypothetical pr...   100   1e-21
Z83245-2|CAB05831.1|  136|Caenorhabditis elegans Hypothetical pr...   100   1e-21
Z82271-1|CAB05209.1|  136|Caenorhabditis elegans Hypothetical pr...   100   1e-21
Z81495-3|CAB04057.1|  136|Caenorhabditis elegans Hypothetical pr...   100   1e-21
Z73102-11|CAA97411.1|  136|Caenorhabditis elegans Hypothetical p...   100   1e-21
Z68336-2|CAA92733.1|  136|Caenorhabditis elegans Hypothetical pr...   100   1e-21
X15634-2|CAA33644.1|  136|Caenorhabditis elegans Histone protein...   100   1e-21
U64845-9|AAC48033.1|  136|Caenorhabditis elegans Histone protein...   100   1e-21
U64843-9|AAF98226.1|  136|Caenorhabditis elegans Histone protein...   100   1e-21
U64843-4|AAF98231.1|  136|Caenorhabditis elegans Histone protein...   100   1e-21
U58750-10|AAB00650.1|  136|Caenorhabditis elegans Histone protei...   100   1e-21
AF304122-1|AAG50235.1|  136|Caenorhabditis elegans histone H3 pr...   100   1e-21
AF047656-3|AAC05102.1|  136|Caenorhabditis elegans Histone prote...   100   1e-21
AC024696-4|AAK84514.1|  136|Caenorhabditis elegans Histone prote...   100   1e-21
Z38112-1|CAA86228.1|  127|Caenorhabditis elegans Hypothetical pr...    95   3e-20
Z38112-2|CAA86229.1|  126|Caenorhabditis elegans Hypothetical pr...    85   5e-17
U50301-4|AAB37052.1|  118|Caenorhabditis elegans Hypothetical pr...    73   1e-13
Z22178-2|CAA80154.1|  261|Caenorhabditis elegans Hypothetical pr...    64   1e-10
Z22179-3|CAA80160.1|  288|Caenorhabditis elegans Hypothetical pr...    63   2e-10
Z81077-10|CAB03064.1|  151|Caenorhabditis elegans Hypothetical p...    31   0.94 
Z83127-4|CAB05631.1|  872|Caenorhabditis elegans Hypothetical pr...    28   6.7  
L16685-6|ABD63199.1| 1047|Caenorhabditis elegans Trp (transient ...    28   6.7  
L16685-5|AAA28167.3| 1027|Caenorhabditis elegans Trp (transient ...    28   6.7  
AJ276027-1|CAC81654.1| 1027|Caenorhabditis elegans TRP homologou...    28   6.7  
Z81038-14|CAI79153.1|  696|Caenorhabditis elegans Hypothetical p...    27   8.8  
Z81038-13|CAB02755.1|  971|Caenorhabditis elegans Hypothetical p...    27   8.8  

>Z98866-6|CAB11546.1|  136|Caenorhabditis elegans Hypothetical
           protein Y49E10.6 protein.
          Length = 136

 Score =  109 bits (263), Expect = 1e-24
 Identities = 56/59 (94%), Positives = 56/59 (94%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQSAAIGALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGL 104



 Score = 95.9 bits (228), Expect = 2e-20
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPG 45



 Score = 72.5 bits (170), Expect = 2e-13
 Identities = 33/34 (97%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKD+QLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDMQLARRIRGERA 136


>U28732-2|AAB04902.1|  136|Caenorhabditis elegans Histone protein 71
           protein.
          Length = 136

 Score =  109 bits (263), Expect = 1e-24
 Identities = 56/59 (94%), Positives = 56/59 (94%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQSAAIGALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGL 104



 Score = 95.9 bits (228), Expect = 2e-20
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>Z74476-1|CAA98963.1|  136|Caenorhabditis elegans Hypothetical
           protein W05B10.1 protein.
          Length = 136

 Score =  109 bits (261), Expect = 2e-24
 Identities = 55/59 (93%), Positives = 56/59 (94%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELL+RKLPFQRLVREIAQDFKTDL FQSAAIGALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLLRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGL 104



 Score = 80.6 bits (190), Expect = 9e-16
 Identities = 39/45 (86%), Positives = 40/45 (88%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRK LATKAARKSA  TG VKK HR+RPG
Sbjct: 1   MARTKQTARKSTGGKAPRKALATKAARKSAIVTGSVKKVHRFRPG 45



 Score = 71.3 bits (167), Expect = 5e-13
 Identities = 32/34 (94%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKD+QLARRIRGER+
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDMQLARRIRGERS 136


>Z93388-9|CAB07653.1|  136|Caenorhabditis elegans Hypothetical
           protein T10C6.13 protein.
          Length = 136

 Score =  100 bits (239), Expect = 1e-21
 Identities = 50/59 (84%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIR+ PFQRLVREIAQDFKTDL FQS+A+ ALQEA+EAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRRAPFQRLVREIAQDFKTDLRFQSSAVMALQEAAEAYLVGL 104



 Score = 94.3 bits (224), Expect = 7e-20
 Identities = 43/45 (95%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP++GGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPASGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>Z83245-7|CAB05834.1|  136|Caenorhabditis elegans Hypothetical
           protein ZK131.7 protein.
          Length = 136

 Score =  100 bits (239), Expect = 1e-21
 Identities = 50/59 (84%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIR+ PFQRLVREIAQDFKTDL FQS+A+ ALQEA+EAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRRAPFQRLVREIAQDFKTDLRFQSSAVMALQEAAEAYLVGL 104



 Score = 94.3 bits (224), Expect = 7e-20
 Identities = 43/45 (95%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP++GGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPASGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>Z83245-3|CAB05833.1|  136|Caenorhabditis elegans Hypothetical
           protein ZK131.3 protein.
          Length = 136

 Score =  100 bits (239), Expect = 1e-21
 Identities = 50/59 (84%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIR+ PFQRLVREIAQDFKTDL FQS+A+ ALQEA+EAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRRAPFQRLVREIAQDFKTDLRFQSSAVMALQEAAEAYLVGL 104



 Score = 94.3 bits (224), Expect = 7e-20
 Identities = 43/45 (95%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP++GGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPASGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>Z83245-2|CAB05831.1|  136|Caenorhabditis elegans Hypothetical
           protein ZK131.2 protein.
          Length = 136

 Score =  100 bits (239), Expect = 1e-21
 Identities = 50/59 (84%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIR+ PFQRLVREIAQDFKTDL FQS+A+ ALQEA+EAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRRAPFQRLVREIAQDFKTDLRFQSSAVMALQEAAEAYLVGL 104



 Score = 94.3 bits (224), Expect = 7e-20
 Identities = 43/45 (95%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP++GGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPASGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>Z82271-1|CAB05209.1|  136|Caenorhabditis elegans Hypothetical
           protein F54E12.1 protein.
          Length = 136

 Score =  100 bits (239), Expect = 1e-21
 Identities = 50/59 (84%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIR+ PFQRLVREIAQDFKTDL FQS+A+ ALQEA+EAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRRAPFQRLVREIAQDFKTDLRFQSSAVMALQEAAEAYLVGL 104



 Score = 94.3 bits (224), Expect = 7e-20
 Identities = 43/45 (95%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP++GGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPASGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>Z81495-3|CAB04057.1|  136|Caenorhabditis elegans Hypothetical
           protein F08G2.3 protein.
          Length = 136

 Score =  100 bits (239), Expect = 1e-21
 Identities = 50/59 (84%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIR+ PFQRLVREIAQDFKTDL FQS+A+ ALQEA+EAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRRAPFQRLVREIAQDFKTDLRFQSSAVMALQEAAEAYLVGL 104



 Score = 94.3 bits (224), Expect = 7e-20
 Identities = 43/45 (95%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP++GGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPASGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>Z73102-11|CAA97411.1|  136|Caenorhabditis elegans Hypothetical
           protein B0035.10 protein.
          Length = 136

 Score =  100 bits (239), Expect = 1e-21
 Identities = 50/59 (84%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIR+ PFQRLVREIAQDFKTDL FQS+A+ ALQEA+EAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRRAPFQRLVREIAQDFKTDLRFQSSAVMALQEAAEAYLVGL 104



 Score = 94.3 bits (224), Expect = 7e-20
 Identities = 43/45 (95%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP++GGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPASGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>Z68336-2|CAA92733.1|  136|Caenorhabditis elegans Hypothetical
           protein F22B3.2 protein.
          Length = 136

 Score =  100 bits (239), Expect = 1e-21
 Identities = 50/59 (84%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIR+ PFQRLVREIAQDFKTDL FQS+A+ ALQEA+EAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRRAPFQRLVREIAQDFKTDLRFQSSAVMALQEAAEAYLVGL 104



 Score = 94.3 bits (224), Expect = 7e-20
 Identities = 43/45 (95%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP++GGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPASGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>X15634-2|CAA33644.1|  136|Caenorhabditis elegans Histone protein
           protein.
          Length = 136

 Score =  100 bits (239), Expect = 1e-21
 Identities = 50/59 (84%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIR+ PFQRLVREIAQDFKTDL FQS+A+ ALQEA+EAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRRAPFQRLVREIAQDFKTDLRFQSSAVMALQEAAEAYLVGL 104



 Score = 94.3 bits (224), Expect = 7e-20
 Identities = 43/45 (95%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP++GGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPASGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>U64845-9|AAC48033.1|  136|Caenorhabditis elegans Histone protein 6
           protein.
          Length = 136

 Score =  100 bits (239), Expect = 1e-21
 Identities = 50/59 (84%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIR+ PFQRLVREIAQDFKTDL FQS+A+ ALQEA+EAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRRAPFQRLVREIAQDFKTDLRFQSSAVMALQEAAEAYLVGL 104



 Score = 94.3 bits (224), Expect = 7e-20
 Identities = 43/45 (95%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP++GGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPASGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>U64843-9|AAF98226.1|  136|Caenorhabditis elegans Histone protein 17
           protein.
          Length = 136

 Score =  100 bits (239), Expect = 1e-21
 Identities = 50/59 (84%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIR+ PFQRLVREIAQDFKTDL FQS+A+ ALQEA+EAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRRAPFQRLVREIAQDFKTDLRFQSSAVMALQEAAEAYLVGL 104



 Score = 94.3 bits (224), Expect = 7e-20
 Identities = 43/45 (95%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP++GGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPASGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>U64843-4|AAF98231.1|  136|Caenorhabditis elegans Histone protein 27
           protein.
          Length = 136

 Score =  100 bits (239), Expect = 1e-21
 Identities = 50/59 (84%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIR+ PFQRLVREIAQDFKTDL FQS+A+ ALQEA+EAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRRAPFQRLVREIAQDFKTDLRFQSSAVMALQEAAEAYLVGL 104



 Score = 94.3 bits (224), Expect = 7e-20
 Identities = 43/45 (95%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP++GGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPASGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>U58750-10|AAB00650.1|  136|Caenorhabditis elegans Histone protein
           59 protein.
          Length = 136

 Score =  100 bits (239), Expect = 1e-21
 Identities = 50/59 (84%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIR+ PFQRLVREIAQDFKTDL FQS+A+ ALQEA+EAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRRAPFQRLVREIAQDFKTDLRFQSSAVMALQEAAEAYLVGL 104



 Score = 94.3 bits (224), Expect = 7e-20
 Identities = 43/45 (95%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP++GGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPASGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>AF304122-1|AAG50235.1|  136|Caenorhabditis elegans histone H3
           protein.
          Length = 136

 Score =  100 bits (239), Expect = 1e-21
 Identities = 50/59 (84%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIR+ PFQRLVREIAQDFKTDL FQS+A+ ALQEA+EAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRRAPFQRLVREIAQDFKTDLRFQSSAVMALQEAAEAYLVGL 104



 Score = 94.3 bits (224), Expect = 7e-20
 Identities = 43/45 (95%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP++GGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPASGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>AF047656-3|AAC05102.1|  136|Caenorhabditis elegans Histone protein
           32 protein.
          Length = 136

 Score =  100 bits (239), Expect = 1e-21
 Identities = 50/59 (84%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIR+ PFQRLVREIAQDFKTDL FQS+A+ ALQEA+EAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRRAPFQRLVREIAQDFKTDLRFQSSAVMALQEAAEAYLVGL 104



 Score = 94.3 bits (224), Expect = 7e-20
 Identities = 43/45 (95%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP++GGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPASGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>AC024696-4|AAK84514.1|  136|Caenorhabditis elegans Histone protein
           49 protein.
          Length = 136

 Score =  100 bits (239), Expect = 1e-21
 Identities = 50/59 (84%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIR+ PFQRLVREIAQDFKTDL FQS+A+ ALQEA+EAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRRAPFQRLVREIAQDFKTDLRFQSSAVMALQEAAEAYLVGL 104



 Score = 94.3 bits (224), Expect = 7e-20
 Identities = 43/45 (95%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP++GGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPASGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>Z38112-1|CAA86228.1|  127|Caenorhabditis elegans Hypothetical
           protein E03A3.3 protein.
          Length = 127

 Score = 95.5 bits (227), Expect = 3e-20
 Identities = 49/59 (83%), Positives = 52/59 (88%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKST+LL+RKLPFQRLVREIAQD K DL FQSAAI ALQEASE +L  L
Sbjct: 37  TVALREIRRYQKSTDLLLRKLPFQRLVREIAQDVKQDLRFQSAAIQALQEASEYFLVGL 95



 Score = 70.9 bits (166), Expect = 7e-13
 Identities = 32/33 (96%), Positives = 33/33 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER 529
           GLFEDTNLCAIHAKRVTIMPKD+QLARRIRGER
Sbjct: 94  GLFEDTNLCAIHAKRVTIMPKDMQLARRIRGER 126



 Score = 60.5 bits (140), Expect = 1e-09
 Identities = 27/33 (81%), Positives = 29/33 (87%)
 Frame = +3

Query: 159 GGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           GGKAPRKQLATKAARK+A   G VKKPHR+RPG
Sbjct: 4   GGKAPRKQLATKAARKNAIVVGAVKKPHRFRPG 36


>Z38112-2|CAA86229.1|  126|Caenorhabditis elegans Hypothetical
           protein E03A3.4 protein.
          Length = 126

 Score = 84.6 bits (200), Expect = 5e-17
 Identities = 41/57 (71%), Positives = 49/57 (85%)
 Frame = +1

Query: 265 ALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           AL+EIR+YQKSTELL+RKLPFQRLVRE+AQ+   ++ FQSAAI AL EA+EAYL  L
Sbjct: 46  ALKEIRKYQKSTELLVRKLPFQRLVREVAQEIMPNVRFQSAAIQALHEAAEAYLIGL 102



 Score = 63.7 bits (148), Expect = 1e-10
 Identities = 34/44 (77%), Positives = 34/44 (77%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRP 254
           MARTK TARKS GGKAPRK LATKAARK  P  G VKK  RYRP
Sbjct: 1   MARTKHTARKSFGGKAPRKSLATKAARKVFPVDGQVKK--RYRP 42



 Score = 54.0 bits (124), Expect = 9e-08
 Identities = 23/25 (92%), Positives = 25/25 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQL 505
           GLFEDTNLCAIHAKRVTIMPKD+Q+
Sbjct: 101 GLFEDTNLCAIHAKRVTIMPKDMQV 125


>U50301-4|AAB37052.1|  118|Caenorhabditis elegans Hypothetical
           protein F20D6.9 protein.
          Length = 118

 Score = 73.3 bits (172), Expect = 1e-13
 Identities = 39/61 (63%), Positives = 46/61 (75%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWLV 438
           TVALREIR+ Q+STELLI +  F+RLV+E+AQDF TDL F+  AI ALQ A E YL  L 
Sbjct: 28  TVALREIRKQQQSTELLIPRSRFERLVKELAQDFVTDLIFRKDAIDALQAAVEDYLVELF 87

Query: 439 R 441
           R
Sbjct: 88  R 88



 Score = 39.1 bits (87), Expect = 0.003
 Identities = 19/31 (61%), Positives = 22/31 (70%)
 Frame = +2

Query: 434 LFEDTNLCAIHAKRVTIMPKDIQLARRIRGE 526
           LF   NLCAI  KRVTI   +++ ARRIRGE
Sbjct: 86  LFRLGNLCAIKCKRVTIEADNLKFARRIRGE 116


>Z22178-2|CAA80154.1|  261|Caenorhabditis elegans Hypothetical
           protein F54C8.2 protein.
          Length = 261

 Score = 63.7 bits (148), Expect = 1e-10
 Identities = 36/57 (63%), Positives = 41/57 (71%), Gaps = 3/57 (5%)
 Frame = +1

Query: 265 ALREIRRYQKSTELLIRKLPFQRLVREIAQ---DFKTDLXFQSAAIGALQEASEAYL 426
           AL EIR+YQ+S +LLI K PF RLVREI Q    F +DL  +S AI ALQEASEA L
Sbjct: 170 ALEEIRKYQESEDLLIPKAPFARLVREIMQTSTPFSSDLRIRSDAINALQEASEALL 226



 Score = 30.3 bits (65), Expect = 1.2
 Identities = 11/28 (39%), Positives = 20/28 (71%)
 Frame = +2

Query: 434 LFEDTNLCAIHAKRVTIMPKDIQLARRI 517
           +F+ ++L + H+KR T+   D+QL RR+
Sbjct: 229 MFDGSSLISAHSKRATLTTTDVQLYRRL 256


>Z22179-3|CAA80160.1|  288|Caenorhabditis elegans Hypothetical
           protein F58A4.3 protein.
          Length = 288

 Score = 62.9 bits (146), Expect = 2e-10
 Identities = 35/67 (52%), Positives = 44/67 (65%), Gaps = 3/67 (4%)
 Frame = +1

Query: 265 ALREIRRYQKSTELLIRKLPFQRLVREIAQ---DFKTDLXFQSAAIGALQEASEAYLXWL 435
           AL EIR+YQK+ +LLI+K PF RLVREI Q    F  D   +S AI ALQEA+EA+L  +
Sbjct: 197 ALEEIRKYQKTEDLLIQKAPFARLVREIMQTSTPFGADCRIRSDAISALQEAAEAFLVEM 256

Query: 436 VRRHQLV 456
                L+
Sbjct: 257 FEGSSLI 263



 Score = 37.1 bits (82), Expect = 0.011
 Identities = 16/28 (57%), Positives = 22/28 (78%)
 Frame = +2

Query: 434 LFEDTNLCAIHAKRVTIMPKDIQLARRI 517
           +FE ++L + HAKRVT+M  DIQL RR+
Sbjct: 256 MFEGSSLISTHAKRVTLMTTDIQLYRRL 283


>Z81077-10|CAB03064.1|  151|Caenorhabditis elegans Hypothetical
           protein F36A2.10 protein.
          Length = 151

 Score = 30.7 bits (66), Expect = 0.94
 Identities = 15/32 (46%), Positives = 22/32 (68%), Gaps = 2/32 (6%)
 Frame = +3

Query: 126 ARTKQTARKSTGGK--APRKQLATKAARKSAP 215
           +R++  +R ST GK  AP+K + TKAAR  +P
Sbjct: 94  SRSRSRSRSSTRGKKRAPKKAVTTKAARSISP 125


>Z83127-4|CAB05631.1|  872|Caenorhabditis elegans Hypothetical
           protein T23F6.4 protein.
          Length = 872

 Score = 27.9 bits (59), Expect = 6.7
 Identities = 12/34 (35%), Positives = 24/34 (70%), Gaps = 2/34 (5%)
 Frame = +1

Query: 271 REIRRYQKS--TELLIRKLPFQRLVREIAQDFKT 366
           +E+++ ++   T+LL+R LPF+  V+E+   F+T
Sbjct: 737 KEVKQKEQGECTKLLVRNLPFEASVKEVETLFET 770


>L16685-6|ABD63199.1| 1047|Caenorhabditis elegans Trp (transient
           receptor potential)channel family protein 1, isoform b
           protein.
          Length = 1047

 Score = 27.9 bits (59), Expect = 6.7
 Identities = 12/31 (38%), Positives = 22/31 (70%)
 Frame = +1

Query: 151 NLLEVKLRVNNLLQKRRENQRRALVESRSHI 243
           +L E+K  +++L  + R+++RR +V S SHI
Sbjct: 811 DLHEIKQDISSLRYELRDDRRREIVRSSSHI 841


>L16685-5|AAA28167.3| 1027|Caenorhabditis elegans Trp (transient
           receptor potential)channel family protein 1, isoform a
           protein.
          Length = 1027

 Score = 27.9 bits (59), Expect = 6.7
 Identities = 12/31 (38%), Positives = 22/31 (70%)
 Frame = +1

Query: 151 NLLEVKLRVNNLLQKRRENQRRALVESRSHI 243
           +L E+K  +++L  + R+++RR +V S SHI
Sbjct: 791 DLHEIKQDISSLRYELRDDRRREIVRSSSHI 821


>AJ276027-1|CAC81654.1| 1027|Caenorhabditis elegans TRP homologous
           cation channel proteinprotein.
          Length = 1027

 Score = 27.9 bits (59), Expect = 6.7
 Identities = 12/31 (38%), Positives = 22/31 (70%)
 Frame = +1

Query: 151 NLLEVKLRVNNLLQKRRENQRRALVESRSHI 243
           +L E+K  +++L  + R+++RR +V S SHI
Sbjct: 791 DLHEIKQDISSLRYELRDDRRREIVRSSSHI 821


>Z81038-14|CAI79153.1|  696|Caenorhabditis elegans Hypothetical
           protein C25A1.10b protein.
          Length = 696

 Score = 27.5 bits (58), Expect = 8.8
 Identities = 15/35 (42%), Positives = 19/35 (54%)
 Frame = +3

Query: 135 KQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKP 239
           ++ A KST  K   K  A KAA  S+ S+   KKP
Sbjct: 319 EKPAAKSTPAKTTPKPTAKKAASSSSDSSDDEKKP 353


>Z81038-13|CAB02755.1|  971|Caenorhabditis elegans Hypothetical
           protein C25A1.10a protein.
          Length = 971

 Score = 27.5 bits (58), Expect = 8.8
 Identities = 15/35 (42%), Positives = 19/35 (54%)
 Frame = +3

Query: 135 KQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKP 239
           ++ A KST  K   K  A KAA  S+ S+   KKP
Sbjct: 594 EKPAAKSTPAKTTPKPTAKKAASSSSDSSDDEKKP 628


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,245,860
Number of Sequences: 27780
Number of extensions: 218471
Number of successful extensions: 540
Number of sequences better than 10.0: 31
Number of HSP's better than 10.0 without gapping: 465
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 538
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1455289764
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -