SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A23
         (527 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z81586-2|CAB04689.1|  146|Caenorhabditis elegans Hypothetical pr...   104   3e-23
AF016512-1|AAB69445.1|  146|Caenorhabditis elegans ribosomal pro...   104   3e-23
Z83217-2|CAB05680.2|  319|Caenorhabditis elegans Hypothetical pr...    27   8.3  

>Z81586-2|CAB04689.1|  146|Caenorhabditis elegans Hypothetical
           protein T05F1.3 protein.
          Length = 146

 Score =  104 bits (250), Expect = 3e-23
 Identities = 49/89 (55%), Positives = 63/89 (70%), Gaps = 1/89 (1%)
 Frame = +3

Query: 189 WFYVRCAAILRHIYIRSPVGVKTVTKIFGGRKRNGVTPSHFCRSSGSIARKALQSLEALK 368
           WFY R A++ RH+Y R P G+    K++GG KR GV P+HF  S+G+  RKA+Q LE +K
Sbjct: 53  WFYTRAASLARHLYFR-PAGIGAFKKVYGGNKRRGVAPNHFQTSAGNCLRKAVQQLEKIK 111

Query: 369 LVEKVQDG-GRILTTQGRRDLDRIAAQVR 452
            VEK  DG GRIL+ QGR+DLDRIA  +R
Sbjct: 112 WVEKHPDGKGRILSKQGRKDLDRIATSLR 140



 Score = 59.7 bits (138), Expect = 1e-09
 Identities = 28/49 (57%), Positives = 36/49 (73%)
 Frame = +2

Query: 38  RSVTVKDVEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAPYDP 184
           R+ ++KDV+Q +  K++A  LKK+GKVKVPE  DLVK    KELAP DP
Sbjct: 3   RATSIKDVDQHEATKSIAHFLKKSGKVKVPEWSDLVKLGVNKELAPVDP 51


>AF016512-1|AAB69445.1|  146|Caenorhabditis elegans ribosomal
           protein S19 protein.
          Length = 146

 Score =  104 bits (250), Expect = 3e-23
 Identities = 49/89 (55%), Positives = 63/89 (70%), Gaps = 1/89 (1%)
 Frame = +3

Query: 189 WFYVRCAAILRHIYIRSPVGVKTVTKIFGGRKRNGVTPSHFCRSSGSIARKALQSLEALK 368
           WFY R A++ RH+Y R P G+    K++GG KR GV P+HF  S+G+  RKA+Q LE +K
Sbjct: 53  WFYTRAASLARHLYFR-PAGIGAFKKVYGGNKRRGVAPNHFQTSAGNCLRKAVQQLEKIK 111

Query: 369 LVEKVQDG-GRILTTQGRRDLDRIAAQVR 452
            VEK  DG GRIL+ QGR+DLDRIA  +R
Sbjct: 112 WVEKHPDGKGRILSKQGRKDLDRIATSLR 140



 Score = 59.7 bits (138), Expect = 1e-09
 Identities = 28/49 (57%), Positives = 36/49 (73%)
 Frame = +2

Query: 38  RSVTVKDVEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAPYDP 184
           R+ ++KDV+Q +  K++A  LKK+GKVKVPE  DLVK    KELAP DP
Sbjct: 3   RATSIKDVDQHEATKSIAHFLKKSGKVKVPEWSDLVKLGVNKELAPVDP 51


>Z83217-2|CAB05680.2|  319|Caenorhabditis elegans Hypothetical
           protein C10C6.3 protein.
          Length = 319

 Score = 27.1 bits (57), Expect = 8.3
 Identities = 20/58 (34%), Positives = 27/58 (46%)
 Frame = +3

Query: 231 IRSPVGVKTVTKIFGGRKRNGVTPSHFCRSSGSIARKALQSLEALKLVEKVQDGGRIL 404
           I S +  K  T ++ G  R G  P      SGS  +K   +  A+K  EK +D GR L
Sbjct: 141 IESDLKEKPDTNVYTG-SREGYVPPPAKEGSGSGGKKKDMNNVAVKPDEKKKDSGRKL 197


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,682,853
Number of Sequences: 27780
Number of extensions: 236803
Number of successful extensions: 579
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 556
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 574
length of database: 12,740,198
effective HSP length: 77
effective length of database: 10,601,138
effective search space used: 1038911524
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -