SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A19
         (601 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U64857-10|AAC25860.1|  265|Caenorhabditis elegans Hypothetical p...    31   0.83 
AF047662-5|AAC04440.1|  385|Caenorhabditis elegans Hypothetical ...    31   0.83 
Z81463-4|CAB03852.2| 3118|Caenorhabditis elegans Hypothetical pr...    29   3.3  
Z81589-3|CAB04719.1|  256|Caenorhabditis elegans Hypothetical pr...    28   5.9  
Z68216-4|CAA92463.2|  565|Caenorhabditis elegans Hypothetical pr...    28   5.9  
U80838-5|AAT48617.1|  317|Caenorhabditis elegans Hypothetical pr...    27   7.7  

>U64857-10|AAC25860.1|  265|Caenorhabditis elegans Hypothetical
           protein C37C3.3 protein.
          Length = 265

 Score = 30.7 bits (66), Expect = 0.83
 Identities = 10/28 (35%), Positives = 20/28 (71%)
 Frame = +1

Query: 148 SVDQMRQILNEIIDALESPDYASKLDEA 231
           ++D+ R++  EI DA+ +P + + +DEA
Sbjct: 180 NIDEQREVAKEIADAISNPGFNNAIDEA 207


>AF047662-5|AAC04440.1|  385|Caenorhabditis elegans Hypothetical
           protein T22B2.3 protein.
          Length = 385

 Score = 30.7 bits (66), Expect = 0.83
 Identities = 20/81 (24%), Positives = 41/81 (50%), Gaps = 4/81 (4%)
 Frame = +1

Query: 250 EMLKMMQIVFPMVVQIEMETIKHHGFNNSREGIVQ--FTQLIRDLESIDGEVARLHTQIR 423
           E  K+++   P+V+Q  ++  ++      R+GIVQ  +  +  ++  I  ++ ++   IR
Sbjct: 79  EFKKVLESTVPIVIQTRLKISEYIKETEKRDGIVQKPYENVHNEVMQIQRDLGKVVKVIR 138

Query: 424 SHYLP--PVSISSSVDTSL*N 480
             Y+   PV+ S  +D  L N
Sbjct: 139 EKYISSIPVNDSRQIDGLLAN 159


>Z81463-4|CAB03852.2| 3118|Caenorhabditis elegans Hypothetical protein
            C06B8.7 protein.
          Length = 3118

 Score = 28.7 bits (61), Expect = 3.3
 Identities = 21/67 (31%), Positives = 30/67 (44%)
 Frame = -1

Query: 319  GALLSPFLFAQPWGRLFASFSTSHYQQLL*LHRVWKHNQAIPGRL*FHLVFVAFDRLIRF 140
            GAL+   LFA        + S ++YQ +  L+ +  HN A+     +H   VA D  I  
Sbjct: 2461 GALIKNCLFAYNSNSTALALSGNNYQVITLLNNIISHNFAL-----YHDTIVAHDVAINM 2515

Query: 139  EGTTCFS 119
               T FS
Sbjct: 2516 TRNTLFS 2522


>Z81589-3|CAB04719.1|  256|Caenorhabditis elegans Hypothetical
           protein T08G5.7 protein.
          Length = 256

 Score = 27.9 bits (59), Expect = 5.9
 Identities = 12/24 (50%), Positives = 15/24 (62%)
 Frame = +2

Query: 380 RALMVRLPVFILKSEATTCPLCPS 451
           R L V L +FI+ S  T CP CP+
Sbjct: 9   RQLFVILKLFIIMSFMTKCPKCPT 32


>Z68216-4|CAA92463.2|  565|Caenorhabditis elegans Hypothetical
           protein F27C8.5 protein.
          Length = 565

 Score = 27.9 bits (59), Expect = 5.9
 Identities = 18/72 (25%), Positives = 35/72 (48%), Gaps = 1/72 (1%)
 Frame = +1

Query: 91  ILDH-AAMIRN*NMSSPQSVSVDQMRQILNEIIDALESPDYASKLDEAKEAAGNEMLKMM 267
           IL+H  + I   N++S ++ SV  M   +N+++           +DE  +   N M+ +M
Sbjct: 126 ILNHNGSPIMALNIASARAFSV--MDHTMNDLVHGFTEKMTGLGIDEVAKLTANSMIAVM 183

Query: 268 QIVFPMVVQIEM 303
             V PM  ++ +
Sbjct: 184 AAVLPMKKKVPL 195


>U80838-5|AAT48617.1|  317|Caenorhabditis elegans Hypothetical
           protein F47F6.9 protein.
          Length = 317

 Score = 27.5 bits (58), Expect = 7.7
 Identities = 13/38 (34%), Positives = 20/38 (52%)
 Frame = +2

Query: 395 RLPVFILKSEATTCPLCPSVLLLTHLCKTVLKVRPGTL 508
           R  +F +   AT    C  +L++TH     L++ PGTL
Sbjct: 254 RCILFCIVYSATADNKCDKILMITHAYDLNLELTPGTL 291


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,012,771
Number of Sequences: 27780
Number of extensions: 264011
Number of successful extensions: 650
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 636
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 650
length of database: 12,740,198
effective HSP length: 78
effective length of database: 10,573,358
effective search space used: 1279376318
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -