SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A18
         (487 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CU457741-15|CAM36357.1|  110|Caenorhabditis elegans Hypothetical...   121   2e-28
U97016-4|AAN84886.1| 2692|Caenorhabditis elegans Lethal protein ...    29   2.4  
U97016-3|AAN84885.1| 2695|Caenorhabditis elegans Lethal protein ...    29   2.4  
Z70718-5|CAA94670.1|  197|Caenorhabditis elegans Hypothetical pr...    28   4.1  
U14635-13|AAC46654.2|  322|Caenorhabditis elegans Hypothetical p...    27   9.5  
AL132948-25|CAC51048.1|  438|Caenorhabditis elegans Hypothetical...    27   9.5  

>CU457741-15|CAM36357.1|  110|Caenorhabditis elegans Hypothetical
           protein C42C1.14 protein.
          Length = 110

 Score =  121 bits (292), Expect = 2e-28
 Identities = 59/101 (58%), Positives = 72/101 (71%)
 Frame = +1

Query: 31  MVQRLTFRRRLSYNTKSNQRRIVRTPGGRLVYQYVKKPKKIPRCGQCKSKLRGIQPARPA 210
           M  R+T+RRRLSYNT SN++R+V+TPGGRLV QY+KK  +IP+C     KL GI PARP 
Sbjct: 1   MSLRVTYRRRLSYNTTSNKKRLVKTPGGRLVVQYIKKRGQIPKCRDTGVKLHGITPARPI 60

Query: 211 ERSRLCYRKKTVKRVYGGVLCHKCVKQRIVRAFLIEEQKIV 333
               L   ++TV R YGG L    VK+RI RAFL+EEQKIV
Sbjct: 61  ALRLLKRNERTVTRAYGGCLSPNAVKERITRAFLVEEQKIV 101


>U97016-4|AAN84886.1| 2692|Caenorhabditis elegans Lethal protein 363,
            isoform b protein.
          Length = 2692

 Score = 28.7 bits (61), Expect = 2.4
 Identities = 21/78 (26%), Positives = 36/78 (46%), Gaps = 1/78 (1%)
 Frame = +1

Query: 22   SLKMVQRLTFRRRLSYNT-KSNQRRIVRTPGGRLVYQYVKKPKKIPRCGQCKSKLRGIQP 198
            S  +V   +F  +++  T K   R++V      L YQ++ K  + PR  +   +L G+  
Sbjct: 2318 SAPIVSIQSFSSKMNVITSKQRPRKMVIRGSNGLDYQFLLKGHEDPRQDERVMQLFGLVN 2377

Query: 199  ARPAERSRLCYRKKTVKR 252
               A  S  C R  T++R
Sbjct: 2378 TLLANNSETCRRNLTIQR 2395


>U97016-3|AAN84885.1| 2695|Caenorhabditis elegans Lethal protein 363,
            isoform a protein.
          Length = 2695

 Score = 28.7 bits (61), Expect = 2.4
 Identities = 21/78 (26%), Positives = 36/78 (46%), Gaps = 1/78 (1%)
 Frame = +1

Query: 22   SLKMVQRLTFRRRLSYNT-KSNQRRIVRTPGGRLVYQYVKKPKKIPRCGQCKSKLRGIQP 198
            S  +V   +F  +++  T K   R++V      L YQ++ K  + PR  +   +L G+  
Sbjct: 2321 SAPIVSIQSFSSKMNVITSKQRPRKMVIRGSNGLDYQFLLKGHEDPRQDERVMQLFGLVN 2380

Query: 199  ARPAERSRLCYRKKTVKR 252
               A  S  C R  T++R
Sbjct: 2381 TLLANNSETCRRNLTIQR 2398


>Z70718-5|CAA94670.1|  197|Caenorhabditis elegans Hypothetical
           protein C04G2.8 protein.
          Length = 197

 Score = 27.9 bits (59), Expect = 4.1
 Identities = 21/70 (30%), Positives = 35/70 (50%), Gaps = 1/70 (1%)
 Frame = +1

Query: 16  SKSLKMVQRLTFRRRLSYNTKSNQRRIVRTPG-GRLVYQYVKKPKKIPRCGQCKSKLRGI 192
           S SL +V   + RRR S  ++S++R +VR+   G +  +   +     R G+ +S  R  
Sbjct: 68  SPSLVVVISPSPRRRRSSTSRSSRRSVVRSASRGSVSRRSSSRGSVYGRTGRSRSSKRSR 127

Query: 193 QPARPAERSR 222
             +R   RSR
Sbjct: 128 SRSRSRSRSR 137


>U14635-13|AAC46654.2|  322|Caenorhabditis elegans Hypothetical
           protein C27H5.6 protein.
          Length = 322

 Score = 26.6 bits (56), Expect = 9.5
 Identities = 10/19 (52%), Positives = 12/19 (63%)
 Frame = -2

Query: 252 TFHCFLTVAKTGTFSRSSW 196
           TFHC LTV +    +R SW
Sbjct: 109 TFHCLLTVERVLAVNRVSW 127


>AL132948-25|CAC51048.1|  438|Caenorhabditis elegans Hypothetical
           protein Y39B6A.33 protein.
          Length = 438

 Score = 26.6 bits (56), Expect = 9.5
 Identities = 17/66 (25%), Positives = 33/66 (50%), Gaps = 2/66 (3%)
 Frame = +1

Query: 31  MVQRLTFRRRLSYN--TKSNQRRIVRTPGGRLVYQYVKKPKKIPRCGQCKSKLRGIQPAR 204
           +V +LT +++ +    TK+  +  V  P      + +KKP K+PR     +  +G + A 
Sbjct: 67  VVPKLTKKQQAALEKITKNITQEHVTLPKPSTTSKILKKPAKLPRGNAILALKKGPKAAA 126

Query: 205 PAERSR 222
           PA + +
Sbjct: 127 PAAKKK 132


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 9,283,684
Number of Sequences: 27780
Number of extensions: 198462
Number of successful extensions: 518
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 502
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 518
length of database: 12,740,198
effective HSP length: 76
effective length of database: 10,628,918
effective search space used: 903458030
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -