SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A17
         (656 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z81453-1|CAB03792.1|  260|Caenorhabditis elegans Hypothetical pr...   288   3e-78
AF045646-7|AAK29833.2|  321|Caenorhabditis elegans Hypothetical ...    37   0.014
Z83238-4|CAB05795.1|  341|Caenorhabditis elegans Hypothetical pr...    30   1.7  
Z81589-11|CAI58924.1|  330|Caenorhabditis elegans Hypothetical p...    28   5.1  
Z81555-8|CAB04512.2|  330|Caenorhabditis elegans Hypothetical pr...    28   5.1  
Z68338-1|CAA92757.1|  134|Caenorhabditis elegans Hypothetical pr...    28   5.1  
Z81586-6|CAB04697.2|  393|Caenorhabditis elegans Hypothetical pr...    28   6.7  
U64859-9|AAC69090.1|  378|Caenorhabditis elegans Activated in bl...    28   6.7  
U64859-8|AAC69096.1|  378|Caenorhabditis elegans Prion-like-(q/n...    28   6.7  
U49830-16|AAK31480.1|  392|Caenorhabditis elegans Hypothetical p...    28   6.7  
Z81031-6|CAF31465.2|  199|Caenorhabditis elegans Hypothetical pr...    27   8.9  
Z81031-5|CAF31466.2|  196|Caenorhabditis elegans Hypothetical pr...    27   8.9  
Z81031-4|CAF31468.2|  421|Caenorhabditis elegans Hypothetical pr...    27   8.9  
Z81031-3|CAF31467.1|  455|Caenorhabditis elegans Hypothetical pr...    27   8.9  
Z81031-2|CAF31464.1|  429|Caenorhabditis elegans Hypothetical pr...    27   8.9  
Z81031-1|CAB02718.4|  432|Caenorhabditis elegans Hypothetical pr...    27   8.9  
AF539814-1|AAN16459.1|  421|Caenorhabditis elegans tyramine rece...    27   8.9  
AF539813-1|AAN16458.1|  444|Caenorhabditis elegans tyramine rece...    27   8.9  
AF220526-1|AAF43009.1|  332|Caenorhabditis elegans DNAse II homo...    27   8.9  

>Z81453-1|CAB03792.1|  260|Caenorhabditis elegans Hypothetical
           protein B0250.1 protein.
          Length = 260

 Score =  288 bits (706), Expect = 3e-78
 Identities = 122/171 (71%), Positives = 149/171 (87%)
 Frame = +3

Query: 144 YAERHGYIKGVVKDIIHDPGRGAPLAVVHFRDPYKFKTRKELFIAPEGLYTGQFVYCGKK 323
           YAERHGYIKG+VKDIIHDPGRGAPLA++ FRDPYK+KT K   +A EG++TGQF++CG K
Sbjct: 34  YAERHGYIKGLVKDIIHDPGRGAPLAIIAFRDPYKYKTVKTTVVAAEGMHTGQFIHCGAK 93

Query: 324 ATLEVGNVMPVGAMPEGTIVCNLEEKMGDRGRLARASGNFATVIGHNPDAKRTRVKLPSG 503
           A +++GN++PVG +PEGT +CN+E K GDRG +ARASGN+ATVI HNPD K+TR++LPSG
Sbjct: 94  AQIQIGNIVPVGTLPEGTTICNVENKSGDRGVIARASGNYATVIAHNPDTKKTRIRLPSG 153

Query: 504 AKKVLPSSNRGMVGIVAGGGRIDKPILKAGRAYHKYKVKRNCWPYVRGVAM 656
           AKKV+ S NR M+G+VAGGGR DKP+LKAGR+YHKYK KRN WP VRGVAM
Sbjct: 154 AKKVVQSVNRAMIGLVAGGGRTDKPLLKAGRSYHKYKAKRNSWPRVRGVAM 204



 Score = 40.3 bits (90), Expect = 0.001
 Identities = 18/25 (72%), Positives = 19/25 (76%)
 Frame = +2

Query: 65  QRKGAGSVFVSHTKKRKGAPKLRSL 139
           QRKGAG +F SH K RKGA KLR L
Sbjct: 8   QRKGAGGIFKSHNKHRKGASKLRPL 32


>AF045646-7|AAK29833.2|  321|Caenorhabditis elegans Hypothetical
           protein F56B3.8 protein.
          Length = 321

 Score = 36.7 bits (81), Expect = 0.014
 Identities = 26/95 (27%), Positives = 46/95 (48%), Gaps = 1/95 (1%)
 Frame = +3

Query: 339 GNVMPVGAMPEGTIVCNLEE-KMGDRGRLARASGNFATVIGHNPDAKRTRVKLPSGAKKV 515
           GN  P+G++  GT++ ++E     D     +A+G  AT++ H  D   T VKLP   +  
Sbjct: 160 GNAYPIGSLAAGTVINSIERYPTMDSETFVKAAGTSATIVRHQGDF--TVVKLPHKHEFS 217

Query: 516 LPSSNRGMVGIVAGGGRIDKPILKAGRAYHKYKVK 620
           L  +    VG ++    ID  I  + + + ++  K
Sbjct: 218 LHRTCMATVGRLSHAD-IDGKIFGSAQMHRRFGYK 251


>Z83238-4|CAB05795.1|  341|Caenorhabditis elegans Hypothetical
           protein T08G3.5 protein.
          Length = 341

 Score = 29.9 bits (64), Expect = 1.7
 Identities = 16/63 (25%), Positives = 32/63 (50%)
 Frame = +3

Query: 87  FSFLTRRRGKALLNFAL*XYAERHGYIKGVVKDIIHDPGRGAPLAVVHFRDPYKFKTRKE 266
           +S +T+    AL N ++  ++  HG    +V  ++H P R A L ++  +   K  T  +
Sbjct: 263 YSAVTKNLDIALTNISMICFST-HGLFSTIVMLVVHKPYRQATLQILKIKRIEKIGTANK 321

Query: 267 LFI 275
           +F+
Sbjct: 322 VFL 324


>Z81589-11|CAI58924.1|  330|Caenorhabditis elegans Hypothetical
           protein F58E10.6 protein.
          Length = 330

 Score = 28.3 bits (60), Expect = 5.1
 Identities = 11/27 (40%), Positives = 17/27 (62%)
 Frame = +3

Query: 156 HGYIKGVVKDIIHDPGRGAPLAVVHFR 236
           HG +  +V  I+H P R + LA +HF+
Sbjct: 285 HGVLSTIVMLIVHTPHRKSILATLHFK 311


>Z81555-8|CAB04512.2|  330|Caenorhabditis elegans Hypothetical
           protein F58E10.6 protein.
          Length = 330

 Score = 28.3 bits (60), Expect = 5.1
 Identities = 11/27 (40%), Positives = 17/27 (62%)
 Frame = +3

Query: 156 HGYIKGVVKDIIHDPGRGAPLAVVHFR 236
           HG +  +V  I+H P R + LA +HF+
Sbjct: 285 HGVLSTIVMLIVHTPHRKSILATLHFK 311


>Z68338-1|CAA92757.1|  134|Caenorhabditis elegans Hypothetical
           protein T24B8.1 protein.
          Length = 134

 Score = 28.3 bits (60), Expect = 5.1
 Identities = 14/22 (63%), Positives = 16/22 (72%)
 Frame = +3

Query: 453 IGHNPDAKRTRVKLPSGAKKVL 518
           IGH  D +RTR  LP+G KKVL
Sbjct: 57  IGHGSD-RRTRFVLPNGYKKVL 77


>Z81586-6|CAB04697.2|  393|Caenorhabditis elegans Hypothetical
           protein T05F1.8 protein.
          Length = 393

 Score = 27.9 bits (59), Expect = 6.7
 Identities = 15/44 (34%), Positives = 24/44 (54%), Gaps = 4/44 (9%)
 Frame = -2

Query: 619 LTLYLWYALPAFKIGLSI-RPPPATIP---TMPLLLDGRTFLAP 500
           LT   W+   +FK+ +++ RPPP  +P      L + G T +AP
Sbjct: 309 LTALQWFIYDSFKVAMNLPRPPPPQMPESLKKKLGIPGTTEVAP 352


>U64859-9|AAC69090.1|  378|Caenorhabditis elegans Activated in
           blocked unfolded proteinresponse protein 9 protein.
          Length = 378

 Score = 27.9 bits (59), Expect = 6.7
 Identities = 22/76 (28%), Positives = 27/76 (35%)
 Frame = -3

Query: 612 CTCGMPFQLSK*VCQYVHLQQQYRPCLCCLMAEPSWLQTVALLLYA*HQDCVQSQWRSFQ 433
           C+C    Q     CQ   +QQQ   C C   A+P   QTV +        C QS  +  Q
Sbjct: 37  CSCQQVQQTQSCSCQSAPVQQQAPSCSC---AQPQQTQTVQVQSTQCAPACQQSCRQQCQ 93

Query: 432 RHVPDDLYHPFSLQDC 385
                    P   Q C
Sbjct: 94  SAPAVSQCQPMCQQQC 109


>U64859-8|AAC69096.1|  378|Caenorhabditis elegans
           Prion-like-(q/n-rich)-domain-bearingprotein protein 57
           protein.
          Length = 378

 Score = 27.9 bits (59), Expect = 6.7
 Identities = 22/76 (28%), Positives = 27/76 (35%)
 Frame = -3

Query: 612 CTCGMPFQLSK*VCQYVHLQQQYRPCLCCLMAEPSWLQTVALLLYA*HQDCVQSQWRSFQ 433
           C+C    Q     CQ   +QQQ   C C   A+P   QTV +        C QS  +  Q
Sbjct: 37  CSCQQVQQTQSCSCQSAPVQQQAPSCSC---AQPQQTQTVQVQSTQCAPACQQSCRQQCQ 93

Query: 432 RHVPDDLYHPFSLQDC 385
                    P   Q C
Sbjct: 94  SAPAVSQCQPMCQQQC 109


>U49830-16|AAK31480.1|  392|Caenorhabditis elegans Hypothetical
           protein C33F10.12 protein.
          Length = 392

 Score = 27.9 bits (59), Expect = 6.7
 Identities = 15/44 (34%), Positives = 24/44 (54%), Gaps = 4/44 (9%)
 Frame = -2

Query: 619 LTLYLWYALPAFKIGLSI-RPPPATIP---TMPLLLDGRTFLAP 500
           LT   W+   +FK+ +++ RPPP  +P      L + G T +AP
Sbjct: 309 LTALQWFIYDSFKVAMNLPRPPPPRMPESLKKKLGIPGTTEVAP 352


>Z81031-6|CAF31465.2|  199|Caenorhabditis elegans Hypothetical
           protein C02D4.2c protein.
          Length = 199

 Score = 27.5 bits (58), Expect = 8.9
 Identities = 25/92 (27%), Positives = 39/92 (42%)
 Frame = -2

Query: 595 LPAFKIGLSIRPPPATIPTMPLLLDGRTFLAPDGSFTLVRLASGLCPITVAKFPEARARR 416
           LP   I ++   PP+ IPT+ L+L   T+L       +     G   + VA F    + R
Sbjct: 33  LPPLDIPMTSMKPPSIIPTVELVLGTITYLV-----IIAMTVVGNTLVVVAVF----SYR 83

Query: 415 PLSPIFSSRLHTMVPSGIAPTGITFPTSRVAF 320
           PL  + +  L ++  S +A      P   V F
Sbjct: 84  PLKKVQNYFLVSLAASDLAVAIFVMPLHVVTF 115


>Z81031-5|CAF31466.2|  196|Caenorhabditis elegans Hypothetical
           protein C02D4.2d protein.
          Length = 196

 Score = 27.5 bits (58), Expect = 8.9
 Identities = 25/92 (27%), Positives = 39/92 (42%)
 Frame = -2

Query: 595 LPAFKIGLSIRPPPATIPTMPLLLDGRTFLAPDGSFTLVRLASGLCPITVAKFPEARARR 416
           LP   I ++   PP+ IPT+ L+L   T+L       +     G   + VA F    + R
Sbjct: 30  LPPLDIPMTSMKPPSIIPTVELVLGTITYLV-----IIAMTVVGNTLVVVAVF----SYR 80

Query: 415 PLSPIFSSRLHTMVPSGIAPTGITFPTSRVAF 320
           PL  + +  L ++  S +A      P   V F
Sbjct: 81  PLKKVQNYFLVSLAASDLAVAIFVMPLHVVTF 112


>Z81031-4|CAF31468.2|  421|Caenorhabditis elegans Hypothetical
           protein C02D4.2f protein.
          Length = 421

 Score = 27.5 bits (58), Expect = 8.9
 Identities = 25/92 (27%), Positives = 39/92 (42%)
 Frame = -2

Query: 595 LPAFKIGLSIRPPPATIPTMPLLLDGRTFLAPDGSFTLVRLASGLCPITVAKFPEARARR 416
           LP   I ++   PP+ IPT+ L+L   T+L       +     G   + VA F    + R
Sbjct: 25  LPPLDIPMTSMKPPSIIPTVELVLGTITYLV-----IIAMTVVGNTLVVVAVF----SYR 75

Query: 415 PLSPIFSSRLHTMVPSGIAPTGITFPTSRVAF 320
           PL  + +  L ++  S +A      P   V F
Sbjct: 76  PLKKVQNYFLVSLAASDLAVAIFVMPLHVVTF 107


>Z81031-3|CAF31467.1|  455|Caenorhabditis elegans Hypothetical
           protein C02D4.2e protein.
          Length = 455

 Score = 27.5 bits (58), Expect = 8.9
 Identities = 25/92 (27%), Positives = 39/92 (42%)
 Frame = -2

Query: 595 LPAFKIGLSIRPPPATIPTMPLLLDGRTFLAPDGSFTLVRLASGLCPITVAKFPEARARR 416
           LP   I ++   PP+ IPT+ L+L   T+L       +     G   + VA F    + R
Sbjct: 36  LPPLDIPMTSMKPPSIIPTVELVLGTITYLV-----IIAMTVVGNTLVVVAVF----SYR 86

Query: 415 PLSPIFSSRLHTMVPSGIAPTGITFPTSRVAF 320
           PL  + +  L ++  S +A      P   V F
Sbjct: 87  PLKKVQNYFLVSLAASDLAVAIFVMPLHVVTF 118


>Z81031-2|CAF31464.1|  429|Caenorhabditis elegans Hypothetical
           protein C02D4.2b protein.
          Length = 429

 Score = 27.5 bits (58), Expect = 8.9
 Identities = 25/92 (27%), Positives = 39/92 (42%)
 Frame = -2

Query: 595 LPAFKIGLSIRPPPATIPTMPLLLDGRTFLAPDGSFTLVRLASGLCPITVAKFPEARARR 416
           LP   I ++   PP+ IPT+ L+L   T+L       +     G   + VA F    + R
Sbjct: 33  LPPLDIPMTSMKPPSIIPTVELVLGTITYLV-----IIAMTVVGNTLVVVAVF----SYR 83

Query: 415 PLSPIFSSRLHTMVPSGIAPTGITFPTSRVAF 320
           PL  + +  L ++  S +A      P   V F
Sbjct: 84  PLKKVQNYFLVSLAASDLAVAIFVMPLHVVTF 115


>Z81031-1|CAB02718.4|  432|Caenorhabditis elegans Hypothetical
           protein C02D4.2a protein.
          Length = 432

 Score = 27.5 bits (58), Expect = 8.9
 Identities = 25/92 (27%), Positives = 39/92 (42%)
 Frame = -2

Query: 595 LPAFKIGLSIRPPPATIPTMPLLLDGRTFLAPDGSFTLVRLASGLCPITVAKFPEARARR 416
           LP   I ++   PP+ IPT+ L+L   T+L       +     G   + VA F    + R
Sbjct: 36  LPPLDIPMTSMKPPSIIPTVELVLGTITYLV-----IIAMTVVGNTLVVVAVF----SYR 86

Query: 415 PLSPIFSSRLHTMVPSGIAPTGITFPTSRVAF 320
           PL  + +  L ++  S +A      P   V F
Sbjct: 87  PLKKVQNYFLVSLAASDLAVAIFVMPLHVVTF 118


>AF539814-1|AAN16459.1|  421|Caenorhabditis elegans tyramine
           receptor short isoformSER-2a protein.
          Length = 421

 Score = 27.5 bits (58), Expect = 8.9
 Identities = 25/92 (27%), Positives = 39/92 (42%)
 Frame = -2

Query: 595 LPAFKIGLSIRPPPATIPTMPLLLDGRTFLAPDGSFTLVRLASGLCPITVAKFPEARARR 416
           LP   I ++   PP+ IPT+ L+L   T+L       +     G   + VA F    + R
Sbjct: 25  LPPLDIPMTSMKPPSIIPTVELVLGTITYLV-----IIAMAVVGNTLVVVAVF----SYR 75

Query: 415 PLSPIFSSRLHTMVPSGIAPTGITFPTSRVAF 320
           PL  + +  L ++  S +A      P   V F
Sbjct: 76  PLKKVQNYFLVSLAASDLAVAIFVMPLHVVTF 107


>AF539813-1|AAN16458.1|  444|Caenorhabditis elegans tyramine
           receptor long isoformSER-2 protein.
          Length = 444

 Score = 27.5 bits (58), Expect = 8.9
 Identities = 25/92 (27%), Positives = 39/92 (42%)
 Frame = -2

Query: 595 LPAFKIGLSIRPPPATIPTMPLLLDGRTFLAPDGSFTLVRLASGLCPITVAKFPEARARR 416
           LP   I ++   PP+ IPT+ L+L   T+L       +     G   + VA F    + R
Sbjct: 25  LPPLDIPMTSMKPPSIIPTVELVLGTITYLV-----IIAMTVVGNTLVVVAVF----SYR 75

Query: 415 PLSPIFSSRLHTMVPSGIAPTGITFPTSRVAF 320
           PL  + +  L ++  S +A      P   V F
Sbjct: 76  PLKKVQNYFLVSLAASDLAVAIFVMPLHVVTF 107


>AF220526-1|AAF43009.1|  332|Caenorhabditis elegans DNAse II homolog
           F09G8.2 protein.
          Length = 332

 Score = 27.5 bits (58), Expect = 8.9
 Identities = 23/87 (26%), Positives = 40/87 (45%)
 Frame = -1

Query: 521 WQNLLGSRR*LYSCTLSIRIVSNHSGEVSRGTCQTTSITHFLFKIAHNGTLRHSSNRHHI 342
           W +L+  +      TL++    N SG+    TC +TS TH + ++   G L  +S++ H 
Sbjct: 209 WNDLISRQN---KVTLAVESWLNGSGDDIHTTCTSTSQTHDVTEMRVTG-LNFASSKDH- 263

Query: 341 SNFKSCFLSTINKLACVEPFGSNEELL 261
           S + +   S  N + C E     +  L
Sbjct: 264 SKW-AVSNSQTNPIVCFEDMNRQKSQL 289


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,056,367
Number of Sequences: 27780
Number of extensions: 360659
Number of successful extensions: 905
Number of sequences better than 10.0: 19
Number of HSP's better than 10.0 without gapping: 870
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 905
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1465835342
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -