SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A16
         (653 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF016431-1|AAC24248.2|  311|Caenorhabditis elegans Hypothetical ...    34   0.077
Z81589-9|CAJ85769.1|  926|Caenorhabditis elegans Hypothetical pr...    33   0.13 
Z81589-8|CAB04720.1|  923|Caenorhabditis elegans Hypothetical pr...    33   0.13 
U41007-1|AAA82264.1|  326|Caenorhabditis elegans Hypothetical pr...    33   0.18 
Z37139-8|CAA85487.1|  376|Caenorhabditis elegans Hypothetical pr...    29   2.9  
Z81570-3|CAB04603.1|  351|Caenorhabditis elegans Hypothetical pr...    29   3.8  
Z73978-3|CAA98293.1|  501|Caenorhabditis elegans Hypothetical pr...    29   3.8  
AC024794-2|AAK68498.1|  618|Caenorhabditis elegans Hypothetical ...    29   3.8  
U41278-1|AAK31511.1|  305|Caenorhabditis elegans Hypothetical pr...    28   5.0  
AF077529-1|AAC26253.1|  690|Caenorhabditis elegans Hypothetical ...    28   5.0  
AC024817-40|AAF59577.4|  967|Caenorhabditis elegans Hypothetical...    28   5.0  
AF000261-8|AAB52929.1|  376|Caenorhabditis elegans T box family ...    27   8.8  
AC025716-6|AAK95889.1|  401|Caenorhabditis elegans Hypothetical ...    27   8.8  

>AF016431-1|AAC24248.2|  311|Caenorhabditis elegans Hypothetical
           protein C10B5.1 protein.
          Length = 311

 Score = 34.3 bits (75), Expect = 0.077
 Identities = 22/82 (26%), Positives = 43/82 (52%), Gaps = 5/82 (6%)
 Frame = +2

Query: 212 RLLAGSKNGYVYAYNLQTNRVQQKIQVGQAP----ILHLIHTDSHLITQEKGG-KLKVFE 376
           +LL GS+NG V A+ L++  ++  + V +       + +   D+ +  +     +L+  E
Sbjct: 27  QLLVGSQNGMVQAFGLESKIMEHIVYVDEEERRIQSIEISGNDTFVYIRSYAVLQLRKPE 86

Query: 377 LTNSGYEEDAVIEVDYPGFCRF 442
           ++ S ++    IEVD+ GFC F
Sbjct: 87  MSKSTWKVIRTIEVDHVGFCNF 108


>Z81589-9|CAJ85769.1|  926|Caenorhabditis elegans Hypothetical
           protein T08G5.5b protein.
          Length = 926

 Score = 33.5 bits (73), Expect = 0.13
 Identities = 34/130 (26%), Positives = 58/130 (44%), Gaps = 9/130 (6%)
 Frame = +2

Query: 209 ERLLAGSKNGYVYAYNLQTNRVQQKI-----QVGQAPILHL-IHTDSHLITQEKGGKLKV 370
           + LLAG + G++YAY +  NR   ++        +  ++ L +     L+     G+L  
Sbjct: 28  QTLLAGGRAGHLYAYTISANRRGFELTNICKSFHKKAVMELKVCQREDLLLCVSDGQLMA 87

Query: 371 FELTNSGYEEDAVIEVDYP--GFCRFEANTKLASLYVPEKDYKINIYNFN-GEKLGSLEY 541
            +L++  Y+ + +I    P   F RF   T    LYV     K  +Y F  GEK G  E+
Sbjct: 88  HKLSDPEYKVETLIHKVKPVQTFARFSPKTS-GDLYVIVSSRK-KLYLFKWGEKDGHKEF 145

Query: 542 DDASVKLGDV 571
            + ++    V
Sbjct: 146 IEVALDYNPV 155


>Z81589-8|CAB04720.1|  923|Caenorhabditis elegans Hypothetical
           protein T08G5.5a protein.
          Length = 923

 Score = 33.5 bits (73), Expect = 0.13
 Identities = 34/130 (26%), Positives = 58/130 (44%), Gaps = 9/130 (6%)
 Frame = +2

Query: 209 ERLLAGSKNGYVYAYNLQTNRVQQKI-----QVGQAPILHL-IHTDSHLITQEKGGKLKV 370
           + LLAG + G++YAY +  NR   ++        +  ++ L +     L+     G+L  
Sbjct: 28  QTLLAGGRAGHLYAYTISANRRGFELTNICKSFHKKAVMELKVCQREDLLLCVSDGQLMA 87

Query: 371 FELTNSGYEEDAVIEVDYP--GFCRFEANTKLASLYVPEKDYKINIYNFN-GEKLGSLEY 541
            +L++  Y+ + +I    P   F RF   T    LYV     K  +Y F  GEK G  E+
Sbjct: 88  HKLSDPEYKVETLIHKVKPVQTFARFSPKTS-GDLYVIVSSRK-KLYLFKWGEKDGHKEF 145

Query: 542 DDASVKLGDV 571
            + ++    V
Sbjct: 146 IEVALDYNPV 155


>U41007-1|AAA82264.1|  326|Caenorhabditis elegans Hypothetical
           protein C33H5.7 protein.
          Length = 326

 Score = 33.1 bits (72), Expect = 0.18
 Identities = 18/79 (22%), Positives = 33/79 (41%), Gaps = 1/79 (1%)
 Frame = +2

Query: 140 YTIRNVDNVPVYSLAFSFLPGGLERLLAGSKNGYVYAYNLQTNRVQQKIQVGQAPILHLI 319
           +T+    N     L  SF P     ++ GS +GY+Y Y+++T  +  K         H+ 
Sbjct: 236 FTLEEHQNAQKIPLMASFTPES-SHIMVGSSDGYIYFYDVETGEIALKTLAPNNQTCHIA 294

Query: 320 H-TDSHLITQEKGGKLKVF 373
             +  H +      KL ++
Sbjct: 295 EFSPQHFVAATADTKLTLW 313


>Z37139-8|CAA85487.1|  376|Caenorhabditis elegans Hypothetical
           protein C14B1.4 protein.
          Length = 376

 Score = 29.1 bits (62), Expect = 2.9
 Identities = 13/46 (28%), Positives = 27/46 (58%)
 Frame = +2

Query: 173 YSLAFSFLPGGLERLLAGSKNGYVYAYNLQTNRVQQKIQVGQAPIL 310
           Y +  +F   G + +++GS++  +Y +NLQT  + Q ++    P+L
Sbjct: 302 YCIFANFSVTGGKWIISGSEDCKIYIWNLQTREIVQCLEGHTQPVL 347


>Z81570-3|CAB04603.1|  351|Caenorhabditis elegans Hypothetical
           protein K12G11.4 protein.
          Length = 351

 Score = 28.7 bits (61), Expect = 3.8
 Identities = 13/45 (28%), Positives = 27/45 (60%), Gaps = 1/45 (2%)
 Frame = +2

Query: 323 TDSHLITQEKGGKLKVFELT-NSGYEEDAVIEVDYPGFCRFEANT 454
           T S LI ++ GG L+V +++     E + +++++Y G C  + +T
Sbjct: 9   TQSALIFEKYGGPLEVRQVSVPQPQENELLVKIEYSGICHSDLHT 53


>Z73978-3|CAA98293.1|  501|Caenorhabditis elegans Hypothetical
           protein ZC302.2a protein.
          Length = 501

 Score = 28.7 bits (61), Expect = 3.8
 Identities = 12/42 (28%), Positives = 27/42 (64%)
 Frame = +2

Query: 209 ERLLAGSKNGYVYAYNLQTNRVQQKIQVGQAPILHLIHTDSH 334
           + +++GS++G +  +++QT ++ Q ++    P+L    TDSH
Sbjct: 440 KHIISGSEDGRILVWSIQTKQIVQILEGHTTPVL---ATDSH 478


>AC024794-2|AAK68498.1|  618|Caenorhabditis elegans Hypothetical
           protein Y48G1BM.6 protein.
          Length = 618

 Score = 28.7 bits (61), Expect = 3.8
 Identities = 17/39 (43%), Positives = 21/39 (53%)
 Frame = -2

Query: 373 ENLKLSTFLLGYKVAVSVYKMKNRSLTNLYLLLNSICLE 257
           ENLK S F +      S   +KNR    L+LL + ICLE
Sbjct: 389 ENLKKSAFKVNISNLRSKSCIKNRFRKALHLLQHEICLE 427


>U41278-1|AAK31511.1|  305|Caenorhabditis elegans Hypothetical
           protein F33G12.2 protein.
          Length = 305

 Score = 28.3 bits (60), Expect = 5.0
 Identities = 9/28 (32%), Positives = 20/28 (71%)
 Frame = +2

Query: 206 LERLLAGSKNGYVYAYNLQTNRVQQKIQ 289
           +E + +GS++G+VY Y+L  + +  K++
Sbjct: 238 IEHVASGSEDGFVYVYSLLDSHIVSKLE 265


>AF077529-1|AAC26253.1|  690|Caenorhabditis elegans Hypothetical
           protein C09E8.3 protein.
          Length = 690

 Score = 28.3 bits (60), Expect = 5.0
 Identities = 16/64 (25%), Positives = 30/64 (46%)
 Frame = +2

Query: 302 PILHLIHTDSHLITQEKGGKLKVFELTNSGYEEDAVIEVDYPGFCRFEANTKLASLYVPE 481
           P+       + ++  E+  K++VFE  +  Y E+   +++  GF  F    ++  LY  E
Sbjct: 408 PLYFTKENATKILGNEEKSKIEVFEDLDKSYSEEQKKKLNDDGFA-FLTEKQMERLYGKE 466

Query: 482 KDYK 493
             YK
Sbjct: 467 SPYK 470


>AC024817-40|AAF59577.4|  967|Caenorhabditis elegans Hypothetical
           protein Y54G2A.21 protein.
          Length = 967

 Score = 28.3 bits (60), Expect = 5.0
 Identities = 16/39 (41%), Positives = 22/39 (56%)
 Frame = -2

Query: 373 ENLKLSTFLLGYKVAVSVYKMKNRSLTNLYLLLNSICLE 257
           ENLK S F + +    +   +KNR    L+LL + ICLE
Sbjct: 242 ENLKKSAFKVKFSNLRNKSCIKNRFRKALHLLQHEICLE 280


>AF000261-8|AAB52929.1|  376|Caenorhabditis elegans T box family
           protein 18 protein.
          Length = 376

 Score = 27.5 bits (58), Expect = 8.8
 Identities = 18/78 (23%), Positives = 38/78 (48%)
 Frame = +2

Query: 194 LPGGLERLLAGSKNGYVYAYNLQTNRVQQKIQVGQAPILHLIHTDSHLITQEKGGKLKVF 373
           +  G + +  G     V  +N+   R +  +Q+ ++   +L  T   LI  +    +K++
Sbjct: 257 IENGFKLMSLGIDMSDVKIFNIAI-RKKTPLQIEKSRKPNLDKTIEVLIQYKYLPVIKIY 315

Query: 374 ELTNSGYEEDAVIEVDYP 427
           EL+NSG E+  + +  +P
Sbjct: 316 ELSNSGMEKKEIAQATFP 333


>AC025716-6|AAK95889.1|  401|Caenorhabditis elegans Hypothetical
           protein Y39G10AR.9 protein.
          Length = 401

 Score = 27.5 bits (58), Expect = 8.8
 Identities = 23/88 (26%), Positives = 42/88 (47%)
 Frame = +2

Query: 161 NVPVYSLAFSFLPGGLERLLAGSKNGYVYAYNLQTNRVQQKIQVGQAPILHLIHTDSHLI 340
           +VP  +L FS   GG + +  G ++G+V AYN+   R+  +I   +  +  L +  + LI
Sbjct: 279 SVPT-ALCFSGDEGG-KAVFVGFEDGHVAAYNVSDRRLIGEIVTKKGSVTCLKYYCNRLI 336

Query: 341 TQEKGGKLKVFELTNSGYEEDAVIEVDY 424
                G +  F +  S     ++I  +Y
Sbjct: 337 ASFTTGNVLAFPIL-SLPTSSSIISAEY 363


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,612,005
Number of Sequences: 27780
Number of extensions: 273155
Number of successful extensions: 763
Number of sequences better than 10.0: 13
Number of HSP's better than 10.0 without gapping: 738
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 763
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1455289764
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -