SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A15
         (409 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AC024776-21|AAK68479.1|   65|Caenorhabditis elegans Ribosomal pr...    81   4e-16
AL110477-7|CAB54332.1|  158|Caenorhabditis elegans Hypothetical ...    31   0.32 
AF040645-9|AAB94972.2|  197|Caenorhabditis elegans Hypothetical ...    30   0.74 
U00054-3|AAM48546.1| 12268|Caenorhabditis elegans Hypothetical p...    28   3.0  
U00054-2|AAA50715.2| 13100|Caenorhabditis elegans Hypothetical p...    28   3.0  
AY117398-1|AAM78593.1| 13100|Caenorhabditis elegans mesocentin p...    28   3.0  
Z81116-3|CAB03303.1|  346|Caenorhabditis elegans Hypothetical pr...    27   6.9  
U28929-1|AAN63410.1|  418|Caenorhabditis elegans Hypothetical pr...    27   6.9  
Z81513-6|CAB04176.1|  341|Caenorhabditis elegans Hypothetical pr...    26   9.1  
Z78546-7|CAB01772.1|  375|Caenorhabditis elegans Hypothetical pr...    26   9.1  
U41991-9|AAA83349.1|  297|Caenorhabditis elegans Hypothetical pr...    26   9.1  
AL023830-4|CAA19474.1|  375|Caenorhabditis elegans Hypothetical ...    26   9.1  

>AC024776-21|AAK68479.1|   65|Caenorhabditis elegans Ribosomal
           protein, small subunitprotein 28 protein.
          Length = 65

 Score = 80.6 bits (190), Expect = 4e-16
 Identities = 41/54 (75%), Positives = 46/54 (85%), Gaps = 1/54 (1%)
 Frame = +2

Query: 71  MDKPNVLARVVKVLGRTGSQGQCTQVKVEFIG-ETSRQIIRNVKGPVRDGDILT 229
           MDK   LARV KV+GRTGSQGQCTQV+VEFI  + +R IIRNVKGPVR+GDILT
Sbjct: 1   MDKLT-LARVTKVIGRTGSQGQCTQVRVEFINDQNNRSIIRNVKGPVREGDILT 53


>AL110477-7|CAB54332.1|  158|Caenorhabditis elegans Hypothetical
           protein Y113G7B.11 protein.
          Length = 158

 Score = 31.1 bits (67), Expect = 0.32
 Identities = 15/34 (44%), Positives = 20/34 (58%), Gaps = 3/34 (8%)
 Frame = +1

Query: 1   CFSKHASFGCTC---AYCIKLDITSQNG*TQRSC 93
           C S H+ +   C   +YC+   ITS+NG  QRSC
Sbjct: 27  CLSGHSQYATQCTSQSYCVS--ITSKNGPVQRSC 58


>AF040645-9|AAB94972.2|  197|Caenorhabditis elegans Hypothetical
           protein F52C6.3 protein.
          Length = 197

 Score = 29.9 bits (64), Expect = 0.74
 Identities = 16/42 (38%), Positives = 22/42 (52%)
 Frame = +3

Query: 171 PAVRSSET*KDPSVTETSSLFLNLNVKLGGCDRLLQHYCIRL 296
           P   S E  +DP   E+S +  NLNVK+    + L H  IR+
Sbjct: 64  PLRESEEVTEDPISVESSEVIGNLNVKVAETQQELHHEGIRI 105


>U00054-3|AAM48546.1| 12268|Caenorhabditis elegans Hypothetical
            protein K07E12.1b protein.
          Length = 12268

 Score = 27.9 bits (59), Expect = 3.0
 Identities = 13/24 (54%), Positives = 17/24 (70%)
 Frame = -3

Query: 143  EYTGPENQYGQALSRHEQERWVYP 72
            E TGPE+Q    LS++E+  WVYP
Sbjct: 8246 EPTGPEDQ---KLSKNEKGEWVYP 8266



 Score = 27.9 bits (59), Expect = 3.0
 Identities = 13/24 (54%), Positives = 17/24 (70%)
 Frame = -3

Query: 143  EYTGPENQYGQALSRHEQERWVYP 72
            E TGPE+Q    LS++E+  WVYP
Sbjct: 9290 EPTGPEDQ---KLSKNEKGEWVYP 9310



 Score = 26.2 bits (55), Expect = 9.1
 Identities = 12/24 (50%), Positives = 17/24 (70%)
 Frame = -3

Query: 143  EYTGPENQYGQALSRHEQERWVYP 72
            E TGPE+Q    LS++++  WVYP
Sbjct: 6753 EPTGPEDQ---KLSKNKKGEWVYP 6773



 Score = 26.2 bits (55), Expect = 9.1
 Identities = 12/24 (50%), Positives = 17/24 (70%)
 Frame = -3

Query: 143  EYTGPENQYGQALSRHEQERWVYP 72
            E TGPE+Q    LS++++  WVYP
Sbjct: 7472 EPTGPEDQ---KLSKNKKGEWVYP 7492



 Score = 26.2 bits (55), Expect = 9.1
 Identities = 12/24 (50%), Positives = 17/24 (70%)
 Frame = -3

Query: 143   EYTGPENQYGQALSRHEQERWVYP 72
             E TGPE+Q    LS++++  WVYP
Sbjct: 10009 EPTGPEDQ---KLSKNKKGEWVYP 10029


>U00054-2|AAA50715.2| 13100|Caenorhabditis elegans Hypothetical
            protein K07E12.1a protein.
          Length = 13100

 Score = 27.9 bits (59), Expect = 3.0
 Identities = 13/24 (54%), Positives = 17/24 (70%)
 Frame = -3

Query: 143  EYTGPENQYGQALSRHEQERWVYP 72
            E TGPE+Q    LS++E+  WVYP
Sbjct: 8291 EPTGPEDQ---KLSKNEKGEWVYP 8311



 Score = 27.9 bits (59), Expect = 3.0
 Identities = 13/24 (54%), Positives = 17/24 (70%)
 Frame = -3

Query: 143  EYTGPENQYGQALSRHEQERWVYP 72
            E TGPE+Q    LS++E+  WVYP
Sbjct: 9335 EPTGPEDQ---KLSKNEKGEWVYP 9355



 Score = 26.2 bits (55), Expect = 9.1
 Identities = 12/24 (50%), Positives = 17/24 (70%)
 Frame = -3

Query: 143  EYTGPENQYGQALSRHEQERWVYP 72
            E TGPE+Q    LS++++  WVYP
Sbjct: 6798 EPTGPEDQ---KLSKNKKGEWVYP 6818



 Score = 26.2 bits (55), Expect = 9.1
 Identities = 12/24 (50%), Positives = 17/24 (70%)
 Frame = -3

Query: 143  EYTGPENQYGQALSRHEQERWVYP 72
            E TGPE+Q    LS++++  WVYP
Sbjct: 7517 EPTGPEDQ---KLSKNKKGEWVYP 7537



 Score = 26.2 bits (55), Expect = 9.1
 Identities = 12/24 (50%), Positives = 17/24 (70%)
 Frame = -3

Query: 143   EYTGPENQYGQALSRHEQERWVYP 72
             E TGPE+Q    LS++++  WVYP
Sbjct: 10054 EPTGPEDQ---KLSKNKKGEWVYP 10074


>AY117398-1|AAM78593.1| 13100|Caenorhabditis elegans mesocentin
            protein.
          Length = 13100

 Score = 27.9 bits (59), Expect = 3.0
 Identities = 13/24 (54%), Positives = 17/24 (70%)
 Frame = -3

Query: 143  EYTGPENQYGQALSRHEQERWVYP 72
            E TGPE+Q    LS++E+  WVYP
Sbjct: 8291 EPTGPEDQ---KLSKNEKGEWVYP 8311



 Score = 27.9 bits (59), Expect = 3.0
 Identities = 13/24 (54%), Positives = 17/24 (70%)
 Frame = -3

Query: 143  EYTGPENQYGQALSRHEQERWVYP 72
            E TGPE+Q    LS++E+  WVYP
Sbjct: 9335 EPTGPEDQ---KLSKNEKGEWVYP 9355



 Score = 26.2 bits (55), Expect = 9.1
 Identities = 12/24 (50%), Positives = 17/24 (70%)
 Frame = -3

Query: 143  EYTGPENQYGQALSRHEQERWVYP 72
            E TGPE+Q    LS++++  WVYP
Sbjct: 6798 EPTGPEDQ---KLSKNKKGEWVYP 6818



 Score = 26.2 bits (55), Expect = 9.1
 Identities = 12/24 (50%), Positives = 17/24 (70%)
 Frame = -3

Query: 143  EYTGPENQYGQALSRHEQERWVYP 72
            E TGPE+Q    LS++++  WVYP
Sbjct: 7517 EPTGPEDQ---KLSKNKKGEWVYP 7537



 Score = 26.2 bits (55), Expect = 9.1
 Identities = 12/24 (50%), Positives = 17/24 (70%)
 Frame = -3

Query: 143   EYTGPENQYGQALSRHEQERWVYP 72
             E TGPE+Q    LS++++  WVYP
Sbjct: 10054 EPTGPEDQ---KLSKNKKGEWVYP 10074


>Z81116-3|CAB03303.1|  346|Caenorhabditis elegans Hypothetical
           protein T06C12.3 protein.
          Length = 346

 Score = 26.6 bits (56), Expect = 6.9
 Identities = 12/31 (38%), Positives = 18/31 (58%)
 Frame = -3

Query: 401 FMLCIYSELNTIRWSSLTVL*V*HINLCRWY 309
           + L +YSE N I+W  L+++    I LC  Y
Sbjct: 180 YTLALYSESNVIQWEILSLIIAAGIVLCFQY 210


>U28929-1|AAN63410.1|  418|Caenorhabditis elegans Hypothetical
           protein F09C12.2 protein.
          Length = 418

 Score = 26.6 bits (56), Expect = 6.9
 Identities = 10/25 (40%), Positives = 17/25 (68%), Gaps = 1/25 (4%)
 Frame = +2

Query: 143 QVKVEFIGETSRQIIRNVKGP-VRD 214
           Q+ +E++G    Q+IR +K P +RD
Sbjct: 267 QLLIEYLGTPDEQVIRRIKSPSIRD 291


>Z81513-6|CAB04176.1|  341|Caenorhabditis elegans Hypothetical
           protein F26D2.7 protein.
          Length = 341

 Score = 26.2 bits (55), Expect = 9.1
 Identities = 12/31 (38%), Positives = 20/31 (64%)
 Frame = -3

Query: 401 FMLCIYSELNTIRWSSLTVL*V*HINLCRWY 309
           F++  Y+E NTI+W +L++L    I +C  Y
Sbjct: 180 FIMMPYNENNTIQWKALSLLISAGILICFQY 210


>Z78546-7|CAB01772.1|  375|Caenorhabditis elegans Hypothetical
           protein T21H8.4 protein.
          Length = 375

 Score = 26.2 bits (55), Expect = 9.1
 Identities = 11/27 (40%), Positives = 19/27 (70%), Gaps = 1/27 (3%)
 Frame = +3

Query: 222 SSLFLNLNVKLGGCDRLLQ-HYCIRLR 299
           ++ FLNL +K   CD LL+ ++C ++R
Sbjct: 74  TNFFLNLMIKPSPCDLLLKTYFCSKIR 100


>U41991-9|AAA83349.1|  297|Caenorhabditis elegans Hypothetical
           protein C42D4.11 protein.
          Length = 297

 Score = 26.2 bits (55), Expect = 9.1
 Identities = 13/36 (36%), Positives = 18/36 (50%)
 Frame = -3

Query: 125 NQYGQALSRHEQERWVYPFWLVISSLMQ*AHVQPKL 18
           N+Y  AL+  E E   Y  W    SL++    QPK+
Sbjct: 161 NEYNAALTGLETENETYHIWKTAYSLVERYPSQPKI 196


>AL023830-4|CAA19474.1|  375|Caenorhabditis elegans Hypothetical
           protein T21H8.4 protein.
          Length = 375

 Score = 26.2 bits (55), Expect = 9.1
 Identities = 11/27 (40%), Positives = 19/27 (70%), Gaps = 1/27 (3%)
 Frame = +3

Query: 222 SSLFLNLNVKLGGCDRLLQ-HYCIRLR 299
           ++ FLNL +K   CD LL+ ++C ++R
Sbjct: 74  TNFFLNLMIKPSPCDLLLKTYFCSKIR 100


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 9,022,414
Number of Sequences: 27780
Number of extensions: 164024
Number of successful extensions: 401
Number of sequences better than 10.0: 12
Number of HSP's better than 10.0 without gapping: 382
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 400
length of database: 12,740,198
effective HSP length: 74
effective length of database: 10,684,478
effective search space used: 651753158
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -