SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A12
         (413 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U00033-12|AAC48297.2|   88|Caenorhabditis elegans Ribosomal prot...    61   4e-10
AY819766-1|AAV69856.1| 4250|Caenorhabditis elegans kettin protein.     34   0.035
AF106579-4|AAK82895.1| 4203|Caenorhabditis elegans Kettin (droso...    34   0.035
AF106579-3|ABS19464.1| 4488|Caenorhabditis elegans Kettin (droso...    34   0.035
AF106579-2|AAM45364.1| 4369|Caenorhabditis elegans Kettin (droso...    34   0.035
AF106579-1|AAM45363.1| 4447|Caenorhabditis elegans Kettin (droso...    34   0.035
AB026846-1|BAA90302.2| 4219|Caenorhabditis elegans kettin protein.     34   0.035
U41017-5|AAC48216.2|  495|Caenorhabditis elegans C.elegans homeo...    29   1.0  
AJ427855-1|CAD20808.1|  495|Caenorhabditis elegans CEH-21 protei...    29   1.0  
U80032-4|AAL16309.2| 1553|Caenorhabditis elegans Hypothetical pr...    28   3.1  
Z92967-1|CAB07477.1|  220|Caenorhabditis elegans Hypothetical pr...    27   7.1  
Z81044-11|CAB02809.2|  476|Caenorhabditis elegans Hypothetical p...    27   7.1  
Z73103-3|CAA97423.1|  540|Caenorhabditis elegans Hypothetical pr...    27   7.1  
Z74473-7|CAA98952.1| 3871|Caenorhabditis elegans Hypothetical pr...    26   9.4  
Z74046-5|CAA98557.1| 3871|Caenorhabditis elegans Hypothetical pr...    26   9.4  
AL117195-4|CAB55010.1|  571|Caenorhabditis elegans Hypothetical ...    26   9.4  

>U00033-12|AAC48297.2|   88|Caenorhabditis elegans Ribosomal
           protein, small subunitprotein 21 protein.
          Length = 88

 Score = 60.9 bits (141), Expect = 4e-10
 Identities = 28/51 (54%), Positives = 36/51 (70%), Gaps = 1/51 (1%)
 Frame = +2

Query: 149 QLVIADVDPATGRAAD-TSKMYVVCGAIRRMGESDDCIVRLTKKDGILAKN 298
           Q+   DVDP TGR     S  Y +CGAIRRMGESDD I+RL +KDG++ ++
Sbjct: 33  QIDFVDVDPETGRMIPGKSTRYAICGAIRRMGESDDAILRLAQKDGLVPRD 83



 Score = 54.0 bits (124), Expect = 4e-08
 Identities = 23/31 (74%), Positives = 27/31 (87%)
 Frame = +1

Query: 52  MQNDAGEFVDLYCPRKCSASNRLIHAKDHAS 144
           MQNDAG+ V+LY PRKCS+SNR+I  KDHAS
Sbjct: 1   MQNDAGQTVELYVPRKCSSSNRIIGPKDHAS 31


>AY819766-1|AAV69856.1| 4250|Caenorhabditis elegans kettin protein.
          Length = 4250

 Score = 34.3 bits (75), Expect = 0.035
 Identities = 25/88 (28%), Positives = 41/88 (46%), Gaps = 3/88 (3%)
 Frame = +2

Query: 38   DVHIKCRTTPVNSLTCTARG--NARPATASSTLRTMLQXQLVIADVDPATGRAADTSKMY 211
            ++H+  R TPVN  T       N RP    S ++T+ +   +  D+    G  A+ S  Y
Sbjct: 839  NIHVDLRATPVNDPTMVIEWFVNGRPLLTGSRVKTLNEFGFIALDI---KGAIAEDSGTY 895

Query: 212  VVCGAIRRMGES-DDCIVRLTKKDGILA 292
             V  A   +GE+   C++ +T    IL+
Sbjct: 896  SV-RASNLLGEAIRQCVITVTPAGQILS 922


>AF106579-4|AAK82895.1| 4203|Caenorhabditis elegans Kettin (drosophila
            actin-binding)homolog protein 1, isoform b protein.
          Length = 4203

 Score = 34.3 bits (75), Expect = 0.035
 Identities = 25/88 (28%), Positives = 41/88 (46%), Gaps = 3/88 (3%)
 Frame = +2

Query: 38   DVHIKCRTTPVNSLTCTARG--NARPATASSTLRTMLQXQLVIADVDPATGRAADTSKMY 211
            ++H+  R TPVN  T       N RP    S ++T+ +   +  D+    G  A+ S  Y
Sbjct: 756  NIHVDLRATPVNDPTMVIEWFVNGRPLLTGSRVKTLNEFGFIALDI---KGAIAEDSGTY 812

Query: 212  VVCGAIRRMGES-DDCIVRLTKKDGILA 292
             V  A   +GE+   C++ +T    IL+
Sbjct: 813  SV-RASNLLGEAIRQCVITVTPAGQILS 839


>AF106579-3|ABS19464.1| 4488|Caenorhabditis elegans Kettin (drosophila
            actin-binding)homolog protein 1, isoform a protein.
          Length = 4488

 Score = 34.3 bits (75), Expect = 0.035
 Identities = 25/88 (28%), Positives = 41/88 (46%), Gaps = 3/88 (3%)
 Frame = +2

Query: 38   DVHIKCRTTPVNSLTCTARG--NARPATASSTLRTMLQXQLVIADVDPATGRAADTSKMY 211
            ++H+  R TPVN  T       N RP    S ++T+ +   +  D+    G  A+ S  Y
Sbjct: 1077 NIHVDLRATPVNDPTMVIEWFVNGRPLLTGSRVKTLNEFGFIALDI---KGAIAEDSGTY 1133

Query: 212  VVCGAIRRMGES-DDCIVRLTKKDGILA 292
             V  A   +GE+   C++ +T    IL+
Sbjct: 1134 SV-RASNLLGEAIRQCVITVTPAGQILS 1160


>AF106579-2|AAM45364.1| 4369|Caenorhabditis elegans Kettin (drosophila
            actin-binding)homolog protein 1, isoform d protein.
          Length = 4369

 Score = 34.3 bits (75), Expect = 0.035
 Identities = 25/88 (28%), Positives = 41/88 (46%), Gaps = 3/88 (3%)
 Frame = +2

Query: 38   DVHIKCRTTPVNSLTCTARG--NARPATASSTLRTMLQXQLVIADVDPATGRAADTSKMY 211
            ++H+  R TPVN  T       N RP    S ++T+ +   +  D+    G  A+ S  Y
Sbjct: 1077 NIHVDLRATPVNDPTMVIEWFVNGRPLLTGSRVKTLNEFGFIALDI---KGAIAEDSGTY 1133

Query: 212  VVCGAIRRMGES-DDCIVRLTKKDGILA 292
             V  A   +GE+   C++ +T    IL+
Sbjct: 1134 SV-RASNLLGEAIRQCVITVTPAGQILS 1160


>AF106579-1|AAM45363.1| 4447|Caenorhabditis elegans Kettin (drosophila
            actin-binding)homolog protein 1, isoform c protein.
          Length = 4447

 Score = 34.3 bits (75), Expect = 0.035
 Identities = 25/88 (28%), Positives = 41/88 (46%), Gaps = 3/88 (3%)
 Frame = +2

Query: 38   DVHIKCRTTPVNSLTCTARG--NARPATASSTLRTMLQXQLVIADVDPATGRAADTSKMY 211
            ++H+  R TPVN  T       N RP    S ++T+ +   +  D+    G  A+ S  Y
Sbjct: 1077 NIHVDLRATPVNDPTMVIEWFVNGRPLLTGSRVKTLNEFGFIALDI---KGAIAEDSGTY 1133

Query: 212  VVCGAIRRMGES-DDCIVRLTKKDGILA 292
             V  A   +GE+   C++ +T    IL+
Sbjct: 1134 SV-RASNLLGEAIRQCVITVTPAGQILS 1160


>AB026846-1|BAA90302.2| 4219|Caenorhabditis elegans kettin protein.
          Length = 4219

 Score = 34.3 bits (75), Expect = 0.035
 Identities = 25/88 (28%), Positives = 41/88 (46%), Gaps = 3/88 (3%)
 Frame = +2

Query: 38   DVHIKCRTTPVNSLTCTARG--NARPATASSTLRTMLQXQLVIADVDPATGRAADTSKMY 211
            ++H+  R TPVN  T       N RP    S ++T+ +   +  D+    G  A+ S  Y
Sbjct: 756  NIHVDLRATPVNDPTMVIEWFVNGRPLLTGSRVKTLNEFGFIALDI---KGAIAEDSGTY 812

Query: 212  VVCGAIRRMGES-DDCIVRLTKKDGILA 292
             V  A   +GE+   C++ +T    IL+
Sbjct: 813  SV-RASNLLGEAIRQCVITVTPAGQILS 839


>U41017-5|AAC48216.2|  495|Caenorhabditis elegans C.elegans homeobox
           protein 21 protein.
          Length = 495

 Score = 29.5 bits (63), Expect = 1.0
 Identities = 18/55 (32%), Positives = 26/55 (47%), Gaps = 2/55 (3%)
 Frame = +2

Query: 50  KCRTTPVNSLTCTARGNARPATASSTLRTMLQXQLVIA--DVDPATGRAADTSKM 208
           K RTTP  S   T R ++    ASST  + +     ++  D     GRA +T K+
Sbjct: 195 KIRTTPEQSKAATKRQSSTTVRASSTCGSSVSSTSTVSSPDYTAKKGRATETPKL 249


>AJ427855-1|CAD20808.1|  495|Caenorhabditis elegans CEH-21 protein
           protein.
          Length = 495

 Score = 29.5 bits (63), Expect = 1.0
 Identities = 18/55 (32%), Positives = 26/55 (47%), Gaps = 2/55 (3%)
 Frame = +2

Query: 50  KCRTTPVNSLTCTARGNARPATASSTLRTMLQXQLVIA--DVDPATGRAADTSKM 208
           K RTTP  S   T R ++    ASST  + +     ++  D     GRA +T K+
Sbjct: 195 KIRTTPEQSKAATKRQSSTTVRASSTCGSSVSSTSTVSSPDYTAKKGRATETPKL 249


>U80032-4|AAL16309.2| 1553|Caenorhabditis elegans Hypothetical
           protein C32E12.4 protein.
          Length = 1553

 Score = 27.9 bits (59), Expect = 3.1
 Identities = 16/49 (32%), Positives = 24/49 (48%)
 Frame = +2

Query: 56  RTTPVNSLTCTARGNARPATASSTLRTMLQXQLVIADVDPATGRAADTS 202
           R T   + + T+ GN+  +T+S T R +    + I   DP T RA   S
Sbjct: 56  RPTSYRAGSITSGGNSSNSTSSYTPRNVRAGSVSIGAYDPPTSRADSVS 104


>Z92967-1|CAB07477.1|  220|Caenorhabditis elegans Hypothetical
           protein T25E12.4b protein.
          Length = 220

 Score = 26.6 bits (56), Expect = 7.1
 Identities = 12/39 (30%), Positives = 22/39 (56%)
 Frame = +2

Query: 167 VDPATGRAADTSKMYVVCGAIRRMGESDDCIVRLTKKDG 283
           V  + G  + +S   +   A R +G + DC+V +TK++G
Sbjct: 123 VADSEGAGSYSSFSSIASTASRMLGRAADCLVLMTKRNG 161


>Z81044-11|CAB02809.2|  476|Caenorhabditis elegans Hypothetical
           protein C30H6.4 protein.
          Length = 476

 Score = 26.6 bits (56), Expect = 7.1
 Identities = 12/48 (25%), Positives = 22/48 (45%)
 Frame = +2

Query: 59  TTPVNSLTCTARGNARPATASSTLRTMLQXQLVIADVDPATGRAADTS 202
           TTP  + T T        T++ST  +++    V +  +P T  +  T+
Sbjct: 263 TTPTTTTTTTIPSTTSSTTSTSTTTSVVTTTTVTSTTEPTTSTSTPTT 310


>Z73103-3|CAA97423.1|  540|Caenorhabditis elegans Hypothetical
           protein C08F8.4 protein.
          Length = 540

 Score = 26.6 bits (56), Expect = 7.1
 Identities = 8/20 (40%), Positives = 15/20 (75%)
 Frame = -1

Query: 137 WSLAWMRRLLAEHFLGQYKS 78
           W++AW+RR++ E   G Y++
Sbjct: 359 WTVAWLRRVVYERVEGPYRT 378


>Z74473-7|CAA98952.1| 3871|Caenorhabditis elegans Hypothetical protein
            ZC116.3 protein.
          Length = 3871

 Score = 26.2 bits (55), Expect = 9.4
 Identities = 12/32 (37%), Positives = 16/32 (50%)
 Frame = -2

Query: 250  IRLSHPSDSPTDNIHFRCVSSTTCGGVYVSNH 155
            +RL+  +DS T    FR      CG +Y  NH
Sbjct: 3100 VRLNFTTDSQTTARGFRVNWEAECGAIYRLNH 3131


>Z74046-5|CAA98557.1| 3871|Caenorhabditis elegans Hypothetical protein
            ZC116.3 protein.
          Length = 3871

 Score = 26.2 bits (55), Expect = 9.4
 Identities = 12/32 (37%), Positives = 16/32 (50%)
 Frame = -2

Query: 250  IRLSHPSDSPTDNIHFRCVSSTTCGGVYVSNH 155
            +RL+  +DS T    FR      CG +Y  NH
Sbjct: 3100 VRLNFTTDSQTTARGFRVNWEAECGAIYRLNH 3131


>AL117195-4|CAB55010.1|  571|Caenorhabditis elegans Hypothetical
           protein Y57A10A.5 protein.
          Length = 571

 Score = 26.2 bits (55), Expect = 9.4
 Identities = 15/36 (41%), Positives = 21/36 (58%)
 Frame = -3

Query: 111 AGRAFPRAVQVNEFTGVVLHFICTSTRYTELTDAKK 4
           A  A  RA+ +++F   V+ FIC   R TEL + KK
Sbjct: 430 ATSAESRAIYMHDFLKEVIEFICFLER-TELIEIKK 464


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 8,140,851
Number of Sequences: 27780
Number of extensions: 146555
Number of successful extensions: 412
Number of sequences better than 10.0: 16
Number of HSP's better than 10.0 without gapping: 390
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 411
length of database: 12,740,198
effective HSP length: 74
effective length of database: 10,684,478
effective search space used: 673122114
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -