SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A11
         (457 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z50109-2|CAA90434.1|  105|Caenorhabditis elegans Hypothetical pr...    79   2e-15
AF304121-1|AAG50234.1|  105|Caenorhabditis elegans 60S ribosomal...    79   2e-15
Z75550-7|CAA99925.2|  195|Caenorhabditis elegans Hypothetical pr...    29   1.2  
AF026201-1|AAB71239.1|  113|Caenorhabditis elegans Hypothetical ...    27   6.5  
Z82055-10|CAB04848.2|  659|Caenorhabditis elegans Hypothetical p...    27   8.6  
Z81515-4|CAB04196.1|  739|Caenorhabditis elegans Hypothetical pr...    27   8.6  
Z69665-1|CAA93520.5| 1396|Caenorhabditis elegans Hypothetical pr...    27   8.6  
U39850-12|AAZ32806.1| 1336|Caenorhabditis elegans Hypothetical p...    27   8.6  
U39850-11|AAZ32807.1| 1331|Caenorhabditis elegans Hypothetical p...    27   8.6  
L23646-1|AAA28041.1|  244|Caenorhabditis elegans Hypothetical pr...    27   8.6  

>Z50109-2|CAA90434.1|  105|Caenorhabditis elegans Hypothetical
           protein C09H10.2 protein.
          Length = 105

 Score = 79.0 bits (186), Expect = 2e-15
 Identities = 33/57 (57%), Positives = 42/57 (73%)
 Frame = +2

Query: 254 YGGQSKPIFXXXXXXXXXIVLRLECADCKVRSQVALKRCKHFELGGDKKRKGQMIQF 424
           +GGQ+KPIF         IVLR+EC +CK + Q+ +KRCKHFELGG KK +GQ+IQF
Sbjct: 49  FGGQTKPIFRKKAKTTKKIVLRMECTECKHKKQLPIKRCKHFELGGQKKSRGQVIQF 105



 Score = 31.9 bits (69), Expect = 0.23
 Identities = 18/38 (47%), Positives = 20/38 (52%), Gaps = 1/38 (2%)
 Frame = +3

Query: 111 MVNVPKQRRTY-XXXXXXXXXXXXSQYKKSKERHAAQG 221
           MVNVPK RRT+             +QYKK KE   AQG
Sbjct: 1   MVNVPKARRTFCDGKCRKHTNHKVTQYKKGKESKFAQG 38



 Score = 30.3 bits (65), Expect = 0.69
 Identities = 18/53 (33%), Positives = 27/53 (50%)
 Frame = +1

Query: 136 GRTAKNVNATKYTRYHSTKSPRKGTLPRXRRRYDRKQQGLRWSVQTHLQKEGK 294
           G+  K+ N  K T+Y   K  ++    + RRRYDRKQ G     +   +K+ K
Sbjct: 14  GKCRKHTNH-KVTQY---KKGKESKFAQGRRRYDRKQSGFGGQTKPIFRKKAK 62


>AF304121-1|AAG50234.1|  105|Caenorhabditis elegans 60S ribosomal
           protein L44 L41 protein.
          Length = 105

 Score = 79.0 bits (186), Expect = 2e-15
 Identities = 33/57 (57%), Positives = 42/57 (73%)
 Frame = +2

Query: 254 YGGQSKPIFXXXXXXXXXIVLRLECADCKVRSQVALKRCKHFELGGDKKRKGQMIQF 424
           +GGQ+KPIF         IVLR+EC +CK + Q+ +KRCKHFELGG KK +GQ+IQF
Sbjct: 49  FGGQTKPIFRKKAKTTKKIVLRMECTECKHKKQLPIKRCKHFELGGQKKSRGQVIQF 105



 Score = 31.9 bits (69), Expect = 0.23
 Identities = 18/38 (47%), Positives = 20/38 (52%), Gaps = 1/38 (2%)
 Frame = +3

Query: 111 MVNVPKQRRTY-XXXXXXXXXXXXSQYKKSKERHAAQG 221
           MVNVPK RRT+             +QYKK KE   AQG
Sbjct: 1   MVNVPKARRTFCDGKCRKHTNHKVTQYKKGKESKFAQG 38



 Score = 30.3 bits (65), Expect = 0.69
 Identities = 18/53 (33%), Positives = 27/53 (50%)
 Frame = +1

Query: 136 GRTAKNVNATKYTRYHSTKSPRKGTLPRXRRRYDRKQQGLRWSVQTHLQKEGK 294
           G+  K+ N  K T+Y   K  ++    + RRRYDRKQ G     +   +K+ K
Sbjct: 14  GKCRKHTNH-KVTQY---KKGKESKFAQGRRRYDRKQSGFGGQTKPIFRKKAK 62


>Z75550-7|CAA99925.2|  195|Caenorhabditis elegans Hypothetical
           protein T22C1.9 protein.
          Length = 195

 Score = 29.5 bits (63), Expect = 1.2
 Identities = 9/31 (29%), Positives = 18/31 (58%), Gaps = 1/31 (3%)
 Frame = -1

Query: 244 VYDHNVFXPWA-ACLSLDFLYCDTLCTLWHL 155
           +YDH+ +  W    +S+ F++C   C +W +
Sbjct: 27  IYDHHYYPMWFWIVISVGFVFCTLSCAVWFM 57


>AF026201-1|AAB71239.1|  113|Caenorhabditis elegans Hypothetical
           protein D1079.1 protein.
          Length = 113

 Score = 27.1 bits (57), Expect = 6.5
 Identities = 17/49 (34%), Positives = 28/49 (57%), Gaps = 3/49 (6%)
 Frame = -2

Query: 213 QRAFPW-TFCTVIPCVLCGIYIFC--STSCAVLVRSPFLSSFGTISTNV 76
           QR++P+ TF   +  +LC +YI C    S +V  +  FL +F  + +NV
Sbjct: 30  QRSYPFQTFLAFLDFMLCALYIHCFGLLSISVEYKIAFLYNF-VMDSNV 77


>Z82055-10|CAB04848.2|  659|Caenorhabditis elegans Hypothetical
           protein T26H2.7 protein.
          Length = 659

 Score = 26.6 bits (56), Expect = 8.6
 Identities = 15/56 (26%), Positives = 24/56 (42%)
 Frame = -2

Query: 192 FCTVIPCVLCGIYIFCSTSCAVLVRSPFLSSFGTISTNVKKRYFNPAMTLDTLTFF 25
           FC V+      + IFCS   +  V  P ++ F      + K Y N  ++   L +F
Sbjct: 229 FCQVLLIFATLLPIFCSIPLSSKVVRPLITIFTGFLIGISKNYSNLILSNRFLVYF 284


>Z81515-4|CAB04196.1|  739|Caenorhabditis elegans Hypothetical
           protein F26H11.4 protein.
          Length = 739

 Score = 26.6 bits (56), Expect = 8.6
 Identities = 16/51 (31%), Positives = 25/51 (49%)
 Frame = +1

Query: 136 GRTAKNVNATKYTRYHSTKSPRKGTLPRXRRRYDRKQQGLRWSVQTHLQKE 288
           G   KN+++    R HS+K  RKG L    + + RK  G+    +  L K+
Sbjct: 207 GPAQKNLSSQ---RKHSSKRNRKGLLRNVAKLWGRKSDGIANPTKAMLSKK 254


>Z69665-1|CAA93520.5| 1396|Caenorhabditis elegans Hypothetical
           protein ZK897.1 protein.
          Length = 1396

 Score = 26.6 bits (56), Expect = 8.6
 Identities = 12/30 (40%), Positives = 19/30 (63%)
 Frame = +2

Query: 158 MPQSTQGITVQKVQGKARCPGXEDVMIVNS 247
           +P +T+G TV K + K+R    ED+ + NS
Sbjct: 442 VPVTTRGATVGKRKDKSRSRSIEDLSLFNS 471


>U39850-12|AAZ32806.1| 1336|Caenorhabditis elegans Hypothetical
           protein F52C9.1a protein.
          Length = 1336

 Score = 26.6 bits (56), Expect = 8.6
 Identities = 10/32 (31%), Positives = 17/32 (53%)
 Frame = -1

Query: 199 LDFLYCDTLCTLWHLHFLQYVLRCFGTFTIFE 104
           ++ + C+T   L    FL +V  C+GT T  +
Sbjct: 736 IELIQCETSVKLLDRRFLMHVSICYGTHTFLD 767


>U39850-11|AAZ32807.1| 1331|Caenorhabditis elegans Hypothetical
           protein F52C9.1b protein.
          Length = 1331

 Score = 26.6 bits (56), Expect = 8.6
 Identities = 10/32 (31%), Positives = 17/32 (53%)
 Frame = -1

Query: 199 LDFLYCDTLCTLWHLHFLQYVLRCFGTFTIFE 104
           ++ + C+T   L    FL +V  C+GT T  +
Sbjct: 736 IELIQCETSVKLLDRRFLMHVSICYGTHTFLD 767


>L23646-1|AAA28041.1|  244|Caenorhabditis elegans Hypothetical
           protein F44E2.3 protein.
          Length = 244

 Score = 26.6 bits (56), Expect = 8.6
 Identities = 10/29 (34%), Positives = 18/29 (62%)
 Frame = +2

Query: 314 LRLECADCKVRSQVALKRCKHFELGGDKK 400
           + +E A+CK R + + K+CK  E   ++K
Sbjct: 152 MAVELAECKKRDEESRKKCKQLEAELERK 180


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 10,166,190
Number of Sequences: 27780
Number of extensions: 199652
Number of successful extensions: 629
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 610
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 627
length of database: 12,740,198
effective HSP length: 75
effective length of database: 10,656,698
effective search space used: 809909048
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -