SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A10
         (653 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF036706-2|ABD94090.1|  131|Caenorhabditis elegans Ribosomal pro...   175   3e-44
Z29115-2|CAA82363.1|   91|Caenorhabditis elegans Hypothetical pr...    42   3e-04
AF036706-3|ABD94091.1|  204|Caenorhabditis elegans Hypothetical ...    40   0.002
Z81036-2|CAD30433.1|  431|Caenorhabditis elegans Hypothetical pr...    29   3.8  
Z81036-1|CAB02742.1|  473|Caenorhabditis elegans Hypothetical pr...    29   3.8  
AF291851-1|AAK55968.1|  103|Caenorhabditis elegans G protein sig...    29   3.8  
AL132876-23|CAD92403.1|  210|Caenorhabditis elegans Hypothetical...    28   5.0  
AF039053-9|AAN84838.1|  131|Caenorhabditis elegans Hypothetical ...    28   5.0  
AF039053-8|AAC25878.1|  178|Caenorhabditis elegans Hypothetical ...    28   5.0  
U55366-7|AAA97985.2|  323|Caenorhabditis elegans Serpentine rece...    28   6.7  
Z83111-2|CAB05533.2|  331|Caenorhabditis elegans Hypothetical pr...    27   8.8  
Z46242-15|CAA86337.2| 2507|Caenorhabditis elegans Hypothetical p...    27   8.8  
Z35598-8|CAA84657.2| 2507|Caenorhabditis elegans Hypothetical pr...    27   8.8  
AL032635-4|CAA21601.1|  140|Caenorhabditis elegans Hypothetical ...    27   8.8  

>AF036706-2|ABD94090.1|  131|Caenorhabditis elegans Ribosomal
           protein, small subunitprotein 24 protein.
          Length = 131

 Score =  175 bits (425), Expect = 3e-44
 Identities = 81/116 (69%), Positives = 96/116 (82%), Gaps = 1/116 (0%)
 Frame = +1

Query: 106 TIRTRKFMTNRLLARKQMVCDVLHPGKPTVSKTEIREKLAKMYKVTPDVVFVFGFKTNFG 285
           TIRTRK +TN+LL RKQMV +V+HPG+PTV K +IREK+AK+YK TPD V  FGF++  G
Sbjct: 6   TIRTRKVLTNKLLYRKQMVVEVIHPGRPTVPKADIREKIAKLYKTTPDTVIPFGFESKIG 65

Query: 286 GGKSTGFALIYDTLDLAKKFEPKHRLARHGLYEK-KRPTRKQRKERKNRMKKVRGT 450
           GGKS GFAL+YDT+D AKKFEPK+RL R GL  K ++P RKQRKERKNR KKVRGT
Sbjct: 66  GGKSKGFALVYDTIDFAKKFEPKYRLVRMGLATKVEKPGRKQRKERKNRQKKVRGT 121


>Z29115-2|CAA82363.1|   91|Caenorhabditis elegans Hypothetical
           protein T26G10.3 protein.
          Length = 91

 Score = 42.3 bits (95), Expect = 3e-04
 Identities = 16/33 (48%), Positives = 23/33 (69%)
 Frame = +1

Query: 157 MVCDVLHPGKPTVSKTEIREKLAKMYKVTPDVV 255
           MV +V+ PG+PT  K +IREK+A  Y + PD +
Sbjct: 1   MVAEVILPGRPTTLKADIREKIANFYNINPDTM 33


>AF036706-3|ABD94091.1|  204|Caenorhabditis elegans Hypothetical
           protein T07A9.14 protein.
          Length = 204

 Score = 39.9 bits (89), Expect = 0.002
 Identities = 17/43 (39%), Positives = 26/43 (60%)
 Frame = +1

Query: 301 GFALIYDTLDLAKKFEPKHRLARHGLYEKKRPTRKQRKERKNR 429
           GF L+YDT D A K++P+H  + H      R +  +RKE++ R
Sbjct: 54  GFTLVYDTFDFANKYQPEHS-SNHDGASTSRTSISRRKEKRRR 95


>Z81036-2|CAD30433.1|  431|Caenorhabditis elegans Hypothetical
           protein C16C2.2b protein.
          Length = 431

 Score = 28.7 bits (61), Expect = 3.8
 Identities = 17/52 (32%), Positives = 21/52 (40%)
 Frame = +3

Query: 222 RQNVQGYSRCSVRIRFQDKLRRWQVNWIRFDLRHTRSGQEVRAQAQVSPPRP 377
           RQN QGY     R+RF  K + W       D   T   Q       + PP+P
Sbjct: 201 RQNAQGYRCLMDRLRFAIKTKPWLKALKASDTMVTWVDQRAEFDPFLHPPQP 252


>Z81036-1|CAB02742.1|  473|Caenorhabditis elegans Hypothetical
           protein C16C2.2a protein.
          Length = 473

 Score = 28.7 bits (61), Expect = 3.8
 Identities = 17/52 (32%), Positives = 21/52 (40%)
 Frame = +3

Query: 222 RQNVQGYSRCSVRIRFQDKLRRWQVNWIRFDLRHTRSGQEVRAQAQVSPPRP 377
           RQN QGY     R+RF  K + W       D   T   Q       + PP+P
Sbjct: 201 RQNAQGYRCLMDRLRFAIKTKPWLKALKASDTMVTWVDQRAEFDPFLHPPQP 252


>AF291851-1|AAK55968.1|  103|Caenorhabditis elegans G protein
           signaling regulator EAT-16 protein.
          Length = 103

 Score = 28.7 bits (61), Expect = 3.8
 Identities = 17/52 (32%), Positives = 21/52 (40%)
 Frame = +3

Query: 222 RQNVQGYSRCSVRIRFQDKLRRWQVNWIRFDLRHTRSGQEVRAQAQVSPPRP 377
           RQN QGY     R+RF  K + W       D   T   Q       + PP+P
Sbjct: 1   RQNAQGYRCLMDRLRFAIKTKPWLKALKASDTMVTWVDQRAEFDPFLHPPQP 52


>AL132876-23|CAD92403.1|  210|Caenorhabditis elegans Hypothetical
           protein Y105E8A.28 protein.
          Length = 210

 Score = 28.3 bits (60), Expect = 5.0
 Identities = 15/41 (36%), Positives = 19/41 (46%)
 Frame = +3

Query: 321 HTRSGQEVRAQAQVSPPRPVREEEAHAQTA*RT*EQNEEGP 443
           H R+ +  R +  V PP+   E E  A  A    EQN  GP
Sbjct: 26  HLRNEELHRFRQAVPPPQQAEEAEEEADVAENVVEQNRLGP 66


>AF039053-9|AAN84838.1|  131|Caenorhabditis elegans Hypothetical
           protein C45H4.14b protein.
          Length = 131

 Score = 28.3 bits (60), Expect = 5.0
 Identities = 16/42 (38%), Positives = 23/42 (54%)
 Frame = +1

Query: 313 IYDTLDLAKKFEPKHRLARHGLYEKKRPTRKQRKERKNRMKK 438
           I   LD  KK E KHR A+     +K+  ++Q K+ K  +KK
Sbjct: 17  ILKKLDEKKKTEEKHR-AKQERQAQKKGAKEQAKKEKAELKK 57


>AF039053-8|AAC25878.1|  178|Caenorhabditis elegans Hypothetical
           protein C45H4.14a protein.
          Length = 178

 Score = 28.3 bits (60), Expect = 5.0
 Identities = 16/42 (38%), Positives = 23/42 (54%)
 Frame = +1

Query: 313 IYDTLDLAKKFEPKHRLARHGLYEKKRPTRKQRKERKNRMKK 438
           I   LD  KK E KHR A+     +K+  ++Q K+ K  +KK
Sbjct: 64  ILKKLDEKKKTEEKHR-AKQERQAQKKGAKEQAKKEKAELKK 104


>U55366-7|AAA97985.2|  323|Caenorhabditis elegans Serpentine
           receptor, class x protein74 protein.
          Length = 323

 Score = 27.9 bits (59), Expect = 6.7
 Identities = 20/50 (40%), Positives = 29/50 (58%), Gaps = 3/50 (6%)
 Frame = -1

Query: 218 FSRISVLLTV-GFPGCKTSQTICL-RA-NNLLVMNLRVRIVAVPSLILNY 78
           FS + V L V GF    +   ICL RA NN++V+ +   I   P+L+L+Y
Sbjct: 22  FSSLIVYLYVSGFAEKTSFNVICLVRAVNNIIVLVVNFLIFLFPTLLLSY 71


>Z83111-2|CAB05533.2|  331|Caenorhabditis elegans Hypothetical
           protein F57G8.3 protein.
          Length = 331

 Score = 27.5 bits (58), Expect = 8.8
 Identities = 20/63 (31%), Positives = 33/63 (52%), Gaps = 4/63 (6%)
 Frame = -3

Query: 510 IHLYLAFTSLLGGRTYFRFLGTADL-LHSV---LTFFTLFARGPLLLVQAVAG*PVLGLE 343
           +HL+ A+  +       + + T+ L LH V   + FFT F   P+L++   AG P+  L 
Sbjct: 29  VHLFGAYIIIFKTPDKMKSVRTSMLSLHLVGAFVDFFTSFLTAPVLILPVCAGYPLGVLG 88

Query: 342 LLG 334
           +LG
Sbjct: 89  MLG 91


>Z46242-15|CAA86337.2| 2507|Caenorhabditis elegans Hypothetical
            protein F10F2.1 protein.
          Length = 2507

 Score = 27.5 bits (58), Expect = 8.8
 Identities = 16/46 (34%), Positives = 27/46 (58%)
 Frame = -3

Query: 345  ELLGQIECVVDQSESS*LATSEVCLETEYEHYIGSNLVHFGELLTD 208
            +LL  IE VVD+ + +    S+ C  +E + ++G N+VH    L+D
Sbjct: 1077 DLLSGIERVVDEWKVAECGISDQCNASENQVFVG-NVVHVVSQLSD 1121


>Z35598-8|CAA84657.2| 2507|Caenorhabditis elegans Hypothetical protein
            F10F2.1 protein.
          Length = 2507

 Score = 27.5 bits (58), Expect = 8.8
 Identities = 16/46 (34%), Positives = 27/46 (58%)
 Frame = -3

Query: 345  ELLGQIECVVDQSESS*LATSEVCLETEYEHYIGSNLVHFGELLTD 208
            +LL  IE VVD+ + +    S+ C  +E + ++G N+VH    L+D
Sbjct: 1077 DLLSGIERVVDEWKVAECGISDQCNASENQVFVG-NVVHVVSQLSD 1121


>AL032635-4|CAA21601.1|  140|Caenorhabditis elegans Hypothetical
           protein Y51A2A.6 protein.
          Length = 140

 Score = 27.5 bits (58), Expect = 8.8
 Identities = 18/52 (34%), Positives = 23/52 (44%), Gaps = 4/52 (7%)
 Frame = +1

Query: 268 FKTNFGGGKSTGFALI----YDTLDLAKKFEPKHRLARHGLYEKKRPTRKQR 411
           F  N GGGK+ GF+        + +  KK    H    HG   + RPTR  R
Sbjct: 21  FVKNNGGGKNHGFSSASSSSSSSSEEGKKHGHGHHHHNHGRPSRPRPTRPPR 72


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,908,332
Number of Sequences: 27780
Number of extensions: 316706
Number of successful extensions: 986
Number of sequences better than 10.0: 14
Number of HSP's better than 10.0 without gapping: 941
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 981
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1455289764
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -