SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A09
         (627 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z69664-1|CAA93514.1|  325|Caenorhabditis elegans Hypothetical pr...   133   9e-32
Z37139-8|CAA85487.1|  376|Caenorhabditis elegans Hypothetical pr...    56   3e-08
Z78544-3|CAB01760.1|  395|Caenorhabditis elegans Hypothetical pr...    55   4e-08
AF000265-5|AAK68197.1|  331|Caenorhabditis elegans Hypothetical ...    55   4e-08
Z81113-5|CAB03282.3|  404|Caenorhabditis elegans Hypothetical pr...    54   8e-08
AF164430-1|AAF82632.1|  404|Caenorhabditis elegans LIS-1 protein.      54   8e-08
AL032627-14|CAA21549.1|  386|Caenorhabditis elegans Hypothetical...    52   3e-07
Z74030-18|CAA98448.1|  494|Caenorhabditis elegans Hypothetical p...    51   8e-07
Z73970-6|CAA98247.1|  494|Caenorhabditis elegans Hypothetical pr...    51   8e-07
AF039711-10|AAB96707.2|  567|Caenorhabditis elegans Yeast prp (s...    51   8e-07
Z73978-3|CAA98293.1|  501|Caenorhabditis elegans Hypothetical pr...    50   1e-06
Z79757-3|CAC42307.1|  585|Caenorhabditis elegans Hypothetical pr...    50   2e-06
Z79757-2|CAB02129.2|  587|Caenorhabditis elegans Hypothetical pr...    50   2e-06
Z66561-2|CAA91460.1|  331|Caenorhabditis elegans Hypothetical pr...    50   2e-06
AF020788-1|AAC47809.1|  587|Caenorhabditis elegans SEL-10 protein.     50   2e-06
Z68342-4|CAA92776.1| 1000|Caenorhabditis elegans Hypothetical pr...    48   7e-06
U28730-7|AAA68258.2|  665|Caenorhabditis elegans Abnormal cell l...    47   1e-05
AF275253-1|AAG28037.1|  665|Caenorhabditis elegans LIN-23 protein.     47   1e-05
Z80215-3|CAB02270.1|  496|Caenorhabditis elegans Hypothetical pr...    47   1e-05
AL021487-10|CAA16357.2| 1592|Caenorhabditis elegans Hypothetical...    46   2e-05
AF106576-4|AAC78176.1|  473|Caenorhabditis elegans Hypothetical ...    46   3e-05
AC024200-12|AAF36010.2| 1232|Caenorhabditis elegans Hypothetical...    46   3e-05
Z92837-1|CAB07400.1| 1043|Caenorhabditis elegans Hypothetical pr...    44   1e-04
AY372076-1|AAQ75758.1| 1043|Caenorhabditis elegans SYM-4 protein.      44   1e-04
Z81097-20|CAB03178.1|  417|Caenorhabditis elegans Hypothetical p...    43   2e-04
AL023833-1|CAA19477.1|  417|Caenorhabditis elegans Hypothetical ...    43   2e-04
AF116530-1|AAD05571.1|  417|Caenorhabditis elegans synthetic mul...    43   2e-04
Z47358-8|CAA87433.1|  702|Caenorhabditis elegans Hypothetical pr...    41   6e-04
AC024770-5|AAK84605.2|  684|Caenorhabditis elegans Hypothetical ...    41   6e-04
Z99278-1|CAB16490.1|  793|Caenorhabditis elegans Hypothetical pr...    41   8e-04
Z81490-1|CAB04014.1|  510|Caenorhabditis elegans Hypothetical pr...    40   0.002
AF330595-1|AAK00353.1|  510|Caenorhabditis elegans SMU-1 protein.      40   0.002
Z71263-5|CAA95824.1|  356|Caenorhabditis elegans Hypothetical pr...    39   0.003
AF291847-1|AAK55964.1|  356|Caenorhabditis elegans heterotrimeri...    39   0.003
Z46242-3|CAA86338.2|  680|Caenorhabditis elegans Hypothetical pr...    38   0.004
Z46242-2|CAA86335.2|  683|Caenorhabditis elegans Hypothetical pr...    38   0.004
U23412-5|AAK21467.2|  492|Caenorhabditis elegans Hypothetical pr...    38   0.004
Z81097-15|CAB03172.1|  412|Caenorhabditis elegans Hypothetical p...    38   0.006
U53340-3|AAA96208.1|  578|Caenorhabditis elegans Hypothetical pr...    38   0.006
AC024867-3|AAK68601.2|  327|Caenorhabditis elegans Eukaryotic in...    38   0.006
Z78413-1|CAB01663.1|  727|Caenorhabditis elegans Hypothetical pr...    38   0.008
AF039038-7|AAM81098.1|  942|Caenorhabditis elegans Hypothetical ...    38   0.008
Z66515-12|CAC42333.1|  860|Caenorhabditis elegans Hypothetical p...    37   0.010
Z66515-11|CAA91354.1|  858|Caenorhabditis elegans Hypothetical p...    37   0.010
Z49127-9|CAA88948.1|  340|Caenorhabditis elegans Hypothetical pr...    37   0.010
Z48178-11|CAC42247.1|  860|Caenorhabditis elegans Hypothetical p...    37   0.010
Z48178-10|CAA88206.1|  858|Caenorhabditis elegans Hypothetical p...    37   0.010
X17497-1|CAA35532.1|  340|Caenorhabditis elegans G-protein protein.    37   0.010
AF291846-1|AAK55963.1|  340|Caenorhabditis elegans heterotrimeri...    37   0.010
AF047651-2|AAL13318.1|  486|Caenorhabditis elegans Hypothetical ...    37   0.014
AF047651-1|AAK67207.1|  484|Caenorhabditis elegans Hypothetical ...    37   0.014
AF040652-5|AAB95022.2|  378|Caenorhabditis elegans Hypothetical ...    37   0.014
U42835-5|AAO61444.1|  517|Caenorhabditis elegans Uncoordinated p...    36   0.018
U42835-4|AAA83588.1|  611|Caenorhabditis elegans Uncoordinated p...    36   0.018
U23139-7|AAK31492.1|  929|Caenorhabditis elegans Hypothetical pr...    36   0.018
AF324437-1|AAK11613.1|  611|Caenorhabditis elegans UNC-78 protein.     36   0.018
Z73906-10|CAB54209.1|  530|Caenorhabditis elegans Hypothetical p...    36   0.024
Z73906-9|CAA98121.1|  571|Caenorhabditis elegans Hypothetical pr...    36   0.024
Z71181-10|CAA94901.2|  678|Caenorhabditis elegans Hypothetical p...    36   0.024
Z71177-11|CAA94873.2|  678|Caenorhabditis elegans Hypothetical p...    36   0.024
U80447-3|AAB37807.2|  910|Caenorhabditis elegans Hypothetical pr...    36   0.024
U80447-5|AAB37809.1|  439|Caenorhabditis elegans Temporarily ass...    36   0.031
U42833-5|AAA83580.1|  444|Caenorhabditis elegans Hypothetical pr...    36   0.031
U88311-6|AAB42347.1|  382|Caenorhabditis elegans Hypothetical pr...    35   0.041
U42438-1|AAN84876.1|  459|Caenorhabditis elegans Maternal effect...    35   0.041
AF016224-1|AAC27121.1|  459|Caenorhabditis elegans WD-40 repeat ...    35   0.041
AF039038-8|AAM81097.1|  874|Caenorhabditis elegans Hypothetical ...    35   0.055
Z83120-6|CAB76722.1|  809|Caenorhabditis elegans Hypothetical pr...    34   0.072
Z48809-2|CAA88747.1|  406|Caenorhabditis elegans Hypothetical pr...    33   0.13 
U89245-1|AAB49459.1|  612|Caenorhabditis elegans transcription f...    33   0.13 
AF003141-10|AAK21487.1|  612|Caenorhabditis elegans Uncoordinate...    33   0.13 
AF001272-1|AAB84235.1|  612|Caenorhabditis elegans enhancer of s...    33   0.13 
AF001271-1|AAB84234.1|  612|Caenorhabditis elegans enhancer of s...    33   0.13 
AC006684-12|AAN60497.1|  528|Caenorhabditis elegans Hypothetical...    33   0.17 
AC006684-11|AAF39968.1|  550|Caenorhabditis elegans Hypothetical...    33   0.17 
Z83016-1|CAB05407.1|  451|Caenorhabditis elegans Hypothetical pr...    33   0.22 
Z68314-8|CAA92666.1|  451|Caenorhabditis elegans Hypothetical pr...    33   0.22 
Z54281-9|CAA91052.1|  451|Caenorhabditis elegans Hypothetical pr...    33   0.22 
Z83122-11|CAB05603.2|  648|Caenorhabditis elegans Hypothetical p...    32   0.29 
Z81523-5|CAB04240.2|  298|Caenorhabditis elegans Hypothetical pr...    32   0.29 
Z81073-10|CAB03035.2|  648|Caenorhabditis elegans Hypothetical p...    32   0.29 
U41007-1|AAA82264.1|  326|Caenorhabditis elegans Hypothetical pr...    32   0.29 
AC024214-18|AAF36083.1|  211|Caenorhabditis elegans Nuclear pore...    32   0.29 
AC024214-17|AAF36082.1|  313|Caenorhabditis elegans Nuclear pore...    32   0.29 
Z31590-4|CAD27606.1|  495|Caenorhabditis elegans Hypothetical pr...    32   0.39 
Z31590-3|CAD27605.1|  607|Caenorhabditis elegans Hypothetical pr...    32   0.39 
Z31590-2|CAD27604.1|  538|Caenorhabditis elegans Hypothetical pr...    32   0.39 
Z31590-1|CAA83461.1|  605|Caenorhabditis elegans Hypothetical pr...    32   0.39 
U23449-4|AAC24299.2|  534|Caenorhabditis elegans Hypothetical pr...    32   0.39 
Z81099-1|CAB03187.1|  600|Caenorhabditis elegans Hypothetical pr...    31   0.51 
Z80216-3|CAB02280.1|  373|Caenorhabditis elegans Hypothetical pr...    31   0.51 
U41007-2|AAA82265.1|  248|Caenorhabditis elegans Hypothetical pr...    31   0.51 
U21321-1|AAG00051.1|  507|Caenorhabditis elegans Fizzy (cdc20 pr...    31   0.51 
AL110490-1|CAB54439.1|  674|Caenorhabditis elegans Hypothetical ...    31   0.89 
Z93390-7|CAB07677.1|  931|Caenorhabditis elegans Hypothetical pr...    30   1.2  
AL132904-13|CAC35846.4|  778|Caenorhabditis elegans Hypothetical...    30   1.2  
AL032675-2|CAA21780.1|  931|Caenorhabditis elegans Hypothetical ...    30   1.2  
U41035-2|AAM69088.1| 1371|Caenorhabditis elegans Uncoordinated p...    30   1.6  
U41035-1|AAB37028.2| 1563|Caenorhabditis elegans Uncoordinated p...    30   1.6  
AF257062-1|AAK49331.1| 1563|Caenorhabditis elegans Rab3-interact...    30   1.6  
AC024791-30|AAL32250.2| 2460|Caenorhabditis elegans Hypothetical...    30   1.6  
AL034393-7|CAA22322.2|  337|Caenorhabditis elegans Hypothetical ...    29   2.1  
AL110478-6|CAE17957.2|  952|Caenorhabditis elegans Hypothetical ...    29   3.6  
Z92813-8|CAB07290.1| 1057|Caenorhabditis elegans Hypothetical pr...    28   4.8  
Z82266-11|CAB05177.4| 1192|Caenorhabditis elegans Hypothetical p...    28   4.8  
Z70213-1|CAA94175.1| 1354|Caenorhabditis elegans Hypothetical pr...    28   4.8  
Z68315-3|CAA92670.1|  430|Caenorhabditis elegans Hypothetical pr...    28   4.8  
Z46676-3|CAA86663.1| 1244|Caenorhabditis elegans Hypothetical pr...    28   4.8  
DQ360810-1|ABC88647.1| 1192|Caenorhabditis elegans intraflagella...    28   4.8  
AL032658-5|CAA21748.1| 1057|Caenorhabditis elegans Hypothetical ...    28   4.8  
AF129126-1|AAD25089.2| 1057|Caenorhabditis elegans POD-1 protein.      28   4.8  
Z92811-5|CAN86600.1| 1580|Caenorhabditis elegans Hypothetical pr...    28   6.3  
Z92811-4|CAB07273.2| 1605|Caenorhabditis elegans Hypothetical pr...    28   6.3  
Z82271-8|CAN86621.1| 1580|Caenorhabditis elegans Hypothetical pr...    28   6.3  
Z82271-7|CAB05214.2| 1605|Caenorhabditis elegans Hypothetical pr...    28   6.3  
Z82271-5|CAI46599.1|  378|Caenorhabditis elegans Hypothetical pr...    28   6.3  
Z81042-1|CAB02795.1| 1657|Caenorhabditis elegans Hypothetical pr...    28   6.3  
Z79756-5|CAB02115.1|  388|Caenorhabditis elegans Hypothetical pr...    28   6.3  
AL032630-10|CAA21566.1|  396|Caenorhabditis elegans Hypothetical...    28   6.3  
AF039038-9|AAO12408.1|  559|Caenorhabditis elegans Hypothetical ...    28   6.3  
AB035591-1|BAB18763.1| 1609|Caenorhabditis elegans kinesin like ...    28   6.3  
Z75525-2|CAA99763.1| 1390|Caenorhabditis elegans Hypothetical pr...    27   8.3  
Z70684-1|CAA94597.1|  580|Caenorhabditis elegans Hypothetical pr...    27   8.3  
U39850-12|AAZ32806.1| 1336|Caenorhabditis elegans Hypothetical p...    27   8.3  
U39850-11|AAZ32807.1| 1331|Caenorhabditis elegans Hypothetical p...    27   8.3  
AC006757-3|AAF60541.2|  916|Caenorhabditis elegans Hypothetical ...    27   8.3  

>Z69664-1|CAA93514.1|  325|Caenorhabditis elegans Hypothetical
           protein K04D7.1 protein.
          Length = 325

 Score =  133 bits (322), Expect = 9e-32
 Identities = 65/111 (58%), Positives = 79/111 (71%), Gaps = 5/111 (4%)
 Frame = +2

Query: 41  MSETLKLRGTLRGHNGWVTQIATNPKYPDM-ILSSSRDKTLIVWKLTR----DENNYGIP 205
           + E +KL GTL GH GWVTQIAT  +     +LSSSRDKT++VW +      DE   G P
Sbjct: 2   VQEQMKLTGTLEGHTGWVTQIATYTRNDKTTVLSSSRDKTILVWDVDSVAPVDEGPIGRP 61

Query: 206 QKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
            + L GH+HF+SDVV+SSDG +ALSGSWDKTLRLWDL  G +TR+F  HTK
Sbjct: 62  VRSLTGHNHFVSDVVISSDGQFALSGSWDKTLRLWDLNQGVSTRQFISHTK 112



 Score = 52.4 bits (120), Expect = 3e-07
 Identities = 33/97 (34%), Positives = 51/97 (52%), Gaps = 1/97 (1%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           +L GHN +V+ +  +       LS S DKTL +W L     N G+  ++   H+  +  V
Sbjct: 64  SLTGHNHFVSDVVISSD-GQFALSGSWDKTLRLWDL-----NQGVSTRQFISHTKDVLSV 117

Query: 248 VLSSDGNYALSGSWDKTLRLWD-LAAGKTTRRFEDHT 355
             S+D    +SGS DK+++LW+ LA  K T   + HT
Sbjct: 118 AFSADNRQIVSGSRDKSIKLWNTLAQCKYTITDDCHT 154



 Score = 49.2 bits (112), Expect = 2e-06
 Identities = 28/84 (33%), Positives = 43/84 (51%), Gaps = 1/84 (1%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPD-MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           H  WV+ +  +P   D +I+S+  DK + VW L     N  +    + GH+ +++ V +S
Sbjct: 153 HTDWVSTVRFSPSNRDPVIVSAGWDKVVKVWNL----GNCRLKTNHI-GHTGYVNTVTVS 207

Query: 257 SDGNYALSGSWDKTLRLWDLAAGK 328
            DG+   SG  D    LWDL  GK
Sbjct: 208 PDGSLCASGGKDGQAMLWDLNEGK 231



 Score = 33.1 bits (72), Expect = 0.17
 Identities = 22/77 (28%), Positives = 36/77 (46%), Gaps = 2/77 (2%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGN--YALSGSWDKTLR 304
           I+S SRDK++ +W  T  +  Y I       H+ ++S V  S        +S  WDK ++
Sbjct: 126 IVSGSRDKSIKLWN-TLAQCKYTITDDC---HTDWVSTVRFSPSNRDPVIVSAGWDKVVK 181

Query: 305 LWDLAAGKTTRRFEDHT 355
           +W+L   +       HT
Sbjct: 182 VWNLGNCRLKTNHIGHT 198


>Z37139-8|CAA85487.1|  376|Caenorhabditis elegans Hypothetical
           protein C14B1.4 protein.
          Length = 376

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 32/100 (32%), Positives = 54/100 (54%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           T ++  TL+GHN +V     NP+   +++S S D+++ +W +       G+  K L  HS
Sbjct: 160 TSRMTKTLKGHNNYVFCCNFNPQ-SSLVVSGSFDESVRIWDVKT-----GMCIKTLPAHS 213

Query: 230 HFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFED 349
             +S V  + DG+   SGS+D  +R+WD A G+  +   D
Sbjct: 214 DPVSAVSFNRDGSLIASGSYDGLVRIWDTANGQCIKTLVD 253



 Score = 53.2 bits (122), Expect = 1e-07
 Identities = 37/126 (29%), Positives = 63/126 (50%), Gaps = 2/126 (1%)
 Frame = +2

Query: 44  SETLKLRGTLRGHNGWVTQIATNP--KYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRL 217
           S   KL  TL GH   ++    +P  KY   + +SS DKT+ +W +     ++ I ++ L
Sbjct: 74  SANYKLMCTLEGHTKSISSAKFSPCGKY---LGTSSADKTVKIWNM-----DHMICERTL 125

Query: 218 YGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV*QNS*FC*GVNA 397
            GH   ++D+  SSD    +S S DKTL+++++   + T+  + H     N  FC   N 
Sbjct: 126 TGHKLGVNDIAWSSDSRCVVSASDDKTLKIFEIVTSRMTKTLKGH----NNYVFCCNFNP 181

Query: 398 DYALKI 415
             +L +
Sbjct: 182 QSSLVV 187



 Score = 44.8 bits (101), Expect = 5e-05
 Identities = 26/96 (27%), Positives = 49/96 (51%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH   V  IA +      ++S+S DKTL ++++           K L GH++++   
Sbjct: 124 TLTGHKLGVNDIAWSSD-SRCVVSASDDKTLKIFEIVTSRMT-----KTLKGHNNYVFCC 177

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             +   +  +SGS+D+++R+WD+  G   +    H+
Sbjct: 178 NFNPQSSLVVSGSFDESVRIWDVKTGMCIKTLPAHS 213



 Score = 44.0 bits (99), Expect = 9e-05
 Identities = 30/105 (28%), Positives = 53/105 (50%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL  H+  V+ ++ N +   +I S S D  + +W    D  N    +  +   +  ++ V
Sbjct: 208 TLPAHSDPVSAVSFN-RDGSLIASGSYDGLVRIW----DTANGQCIKTLVDDENPPVAFV 262

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV*QNS*FC 382
             S +G Y L+ + D TL+LWD + GKT +++  H    +NS +C
Sbjct: 263 KFSPNGKYILASNLDSTLKLWDFSKGKTLKQYTGH----ENSKYC 303



 Score = 31.9 bits (69), Expect = 0.39
 Identities = 24/90 (26%), Positives = 44/90 (48%), Gaps = 3/90 (3%)
 Frame = +2

Query: 98  QIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS---SDGN 268
           + + N KY   IL+S+ D TL +W  ++     G   K+  GH +    +  +   + G 
Sbjct: 263 KFSPNGKY---ILASNLDSTLKLWDFSK-----GKTLKQYTGHENSKYCIFANFSVTGGK 314

Query: 269 YALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           + +SGS D  + +W+L   +  +  E HT+
Sbjct: 315 WIISGSEDCKIYIWNLQTREIVQCLEGHTQ 344


>Z78544-3|CAB01760.1|  395|Caenorhabditis elegans Hypothetical
           protein K04G11.4 protein.
          Length = 395

 Score = 55.2 bits (127), Expect = 4e-08
 Identities = 31/94 (32%), Positives = 44/94 (46%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL+GH  +V     NP    +I S S D+T+ +W        + IP     GH   +S V
Sbjct: 185 TLKGHTNYVFCCCFNPS-GTLIASGSFDETIRIWCARNGNTIFSIP-----GHEDPVSSV 238

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFED 349
             + DG Y  SGS+D  +R+WD   G   +   D
Sbjct: 239 CFNRDGAYLASGSYDGIVRIWDSTTGTCVKTLID 272



 Score = 38.7 bits (86), Expect = 0.003
 Identities = 26/95 (27%), Positives = 45/95 (47%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH   + + + +     +I+S S DK + V+ ++      G   K L GH++++   
Sbjct: 143 TLMGHRLGINEFSWSSD-SKLIVSCSDDKLVKVFDVSS-----GRCVKTLKGHTNYVFCC 196

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             +  G    SGS+D+T+R+W    G T      H
Sbjct: 197 CFNPSGTLIASGSFDETIRIWCARNGNTIFSIPGH 231



 Score = 36.3 bits (80), Expect = 0.018
 Identities = 20/73 (27%), Positives = 40/73 (54%)
 Frame = +2

Query: 137 SSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           S S D ++ +W++        + +K L GH   I++   SSD    +S S DK ++++D+
Sbjct: 124 SGSADCSIKIWRMDF------VYEKTLMGHRLGINEFSWSSDSKLIVSCSDDKLVKVFDV 177

Query: 317 AAGKTTRRFEDHT 355
           ++G+  +  + HT
Sbjct: 178 SSGRCVKTLKGHT 190



 Score = 35.1 bits (77), Expect = 0.041
 Identities = 29/110 (26%), Positives = 48/110 (43%), Gaps = 1/110 (0%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF-ISD 244
           ++ GH   V+ +  N +    + S S D  + +W  T      G   K L    H  I+ 
Sbjct: 227 SIPGHEDPVSSVCFN-RDGAYLASGSYDGIVRIWDSTT-----GTCVKTLIDEEHPPITH 280

Query: 245 VVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV*QNS*FC*GVN 394
           V  S +G Y L+ + + TL+LWD    +  + +  H    +NS +C   N
Sbjct: 281 VKFSPNGKYILASNLNNTLKLWDYQKLRVLKEYTGH----ENSKYCVAAN 326



 Score = 29.1 bits (62), Expect = 2.7
 Identities = 12/29 (41%), Positives = 17/29 (58%)
 Frame = +2

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           H   IS +  S DG Y  SGS D ++++W
Sbjct: 106 HKKSISGIKFSPDGRYMGSGSADCSIKIW 134


>AF000265-5|AAK68197.1|  331|Caenorhabditis elegans Hypothetical
           protein C18E3.5 protein.
          Length = 331

 Score = 55.2 bits (127), Expect = 4e-08
 Identities = 27/99 (27%), Positives = 54/99 (54%), Gaps = 2/99 (2%)
 Frame = +2

Query: 71  LRGHNG--WVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISD 244
           L+GH G  + +Q +++  +   + S+  D+ + +W +  +  N+ +    L GH   I +
Sbjct: 32  LQGHGGEIYTSQFSSDGSF---LASAGYDQQIFLWNVFGECENFAV----LKGHKGAIME 84

Query: 245 VVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
           V  ++D ++ +S   DKT+R+WD+  G   R F+ HT +
Sbjct: 85  VKFNADSSHLVSAGTDKTVRVWDMETGSCIRNFKSHTDI 123



 Score = 37.9 bits (84), Expect = 0.006
 Identities = 20/64 (31%), Positives = 33/64 (51%)
 Frame = +2

Query: 125 DMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLR 304
           D ++    D  + VW + R++  Y      L GH   I+ + +S +GN+ LS S D +L 
Sbjct: 176 DNVICGGIDNQIKVWDMLRNDVRYV-----LSGHRDTITSLSVSHNGNFLLSNSMDCSLM 230

Query: 305 LWDL 316
            WD+
Sbjct: 231 SWDI 234



 Score = 28.7 bits (61), Expect = 3.6
 Identities = 13/38 (34%), Positives = 20/38 (52%)
 Frame = +2

Query: 203 PQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           P   L GH   I     SSDG++  S  +D+ + LW++
Sbjct: 28  PTMVLQGHGGEIYTSQFSSDGSFLASAGYDQQIFLWNV 65


>Z81113-5|CAB03282.3|  404|Caenorhabditis elegans Hypothetical
           protein T03F6.5 protein.
          Length = 404

 Score = 54.0 bits (124), Expect = 8e-08
 Identities = 32/102 (31%), Positives = 49/102 (48%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           ET +L  TL+GH   V  IA +     ++ S S D ++ +W   +  +      K L GH
Sbjct: 136 ETGQLERTLKGHTDAVNDIAIDAAGKQLV-SCSSDLSIKLWDFGQTYDCL----KSLKGH 190

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            H +S V     G++ LS S D T++ WD++ G     F  H
Sbjct: 191 EHTVSSVTFLPTGDFVLSASRDHTIKQWDISTGYCVYTFRGH 232



 Score = 50.4 bits (115), Expect = 1e-06
 Identities = 26/82 (31%), Positives = 42/82 (51%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL  H  WV  +A +PK    ++S + DKTL VW+L+          K +  H HF+S V
Sbjct: 327 TLLAHENWVRGLAFHPK-GKYLISVADDKTLRVWELSAQRC-----MKAIEAHEHFVSTV 380

Query: 248 VLSSDGNYALSGSWDKTLRLWD 313
                  + ++GS D + ++W+
Sbjct: 381 AFHQTSPFVITGSVDMSCKVWE 402



 Score = 46.8 bits (106), Expect = 1e-05
 Identities = 28/95 (29%), Positives = 47/95 (49%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           +L+GH   V+ +   P   D +LS+SRD T+  W ++     Y +   R  GH+ ++  +
Sbjct: 186 SLKGHEHTVSSVTFLPT-GDFVLSASRDHTIKQWDIS---TGYCVYTFR--GHNDWVRMI 239

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            +S+DG    S S D+T+ +W  A         DH
Sbjct: 240 RISNDGTLFASASLDQTVTVWSFATKSAKLVLRDH 274



 Score = 44.0 bits (99), Expect = 9e-05
 Identities = 22/75 (29%), Positives = 39/75 (52%)
 Frame = +2

Query: 128 MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRL 307
           ++ S SRD+++  W +     N G     L  H +++  +     G Y +S + DKTLR+
Sbjct: 304 ILFSGSRDRSIKAWNI-----NTGDVLFTLLAHENWVRGLAFHPKGKYLISVADDKTLRV 358

Query: 308 WDLAAGKTTRRFEDH 352
           W+L+A +  +  E H
Sbjct: 359 WELSAQRCMKAIEAH 373



 Score = 29.9 bits (64), Expect = 1.6
 Identities = 15/49 (30%), Positives = 24/49 (48%)
 Frame = +2

Query: 209 KRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           ++L GH   I+ V+         S S D T+++WD   G+  R  + HT
Sbjct: 100 QKLTGHRLPITRVIFHPLWTIMASCSEDATIKVWDYETGQLERTLKGHT 148


>AF164430-1|AAF82632.1|  404|Caenorhabditis elegans LIS-1 protein.
          Length = 404

 Score = 54.0 bits (124), Expect = 8e-08
 Identities = 32/102 (31%), Positives = 49/102 (48%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           ET +L  TL+GH   V  IA +     ++ S S D ++ +W   +  +      K L GH
Sbjct: 136 ETGQLERTLKGHTDAVNDIAIDAAGKQLV-SCSSDLSIKLWDFGQTYDCL----KSLKGH 190

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            H +S V     G++ LS S D T++ WD++ G     F  H
Sbjct: 191 EHTVSSVTFLPTGDFVLSASRDHTIKQWDISTGYCVYTFRGH 232



 Score = 50.4 bits (115), Expect = 1e-06
 Identities = 26/82 (31%), Positives = 42/82 (51%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL  H  WV  +A +PK    ++S + DKTL VW+L+          K +  H HF+S V
Sbjct: 327 TLLAHENWVRGLAFHPK-GKYLISVADDKTLRVWELSAQRC-----MKAIEAHEHFVSTV 380

Query: 248 VLSSDGNYALSGSWDKTLRLWD 313
                  + ++GS D + ++W+
Sbjct: 381 AFHQTSPFVITGSVDMSCKVWE 402



 Score = 46.8 bits (106), Expect = 1e-05
 Identities = 28/95 (29%), Positives = 47/95 (49%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           +L+GH   V+ +   P   D +LS+SRD T+  W ++     Y +   R  GH+ ++  +
Sbjct: 186 SLKGHEHTVSSVTFLPT-GDFVLSASRDHTIKQWDIS---TGYCVYTFR--GHNDWVRMI 239

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            +S+DG    S S D+T+ +W  A         DH
Sbjct: 240 RISNDGTLFASASLDQTVTVWSFATKSAKLVLRDH 274



 Score = 44.0 bits (99), Expect = 9e-05
 Identities = 22/75 (29%), Positives = 39/75 (52%)
 Frame = +2

Query: 128 MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRL 307
           ++ S SRD+++  W +     N G     L  H +++  +     G Y +S + DKTLR+
Sbjct: 304 ILFSGSRDRSIKAWNI-----NTGDVLFTLLAHENWVRGLAFHPKGKYLISVADDKTLRV 358

Query: 308 WDLAAGKTTRRFEDH 352
           W+L+A +  +  E H
Sbjct: 359 WELSAQRCMKAIEAH 373



 Score = 29.9 bits (64), Expect = 1.6
 Identities = 15/49 (30%), Positives = 24/49 (48%)
 Frame = +2

Query: 209 KRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           ++L GH   I+ V+         S S D T+++WD   G+  R  + HT
Sbjct: 100 QKLTGHRLPITRVIFHPLWTIMASCSEDATIKVWDYETGQLERTLKGHT 148


>AL032627-14|CAA21549.1|  386|Caenorhabditis elegans Hypothetical
           protein Y41C4A.11 protein.
          Length = 386

 Score = 52.0 bits (119), Expect = 3e-07
 Identities = 31/106 (29%), Positives = 54/106 (50%), Gaps = 1/106 (0%)
 Frame = +2

Query: 44  SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
           +ET  L      H+ ++  +  +P  P +I S+S D+ + VW     EN + + Q+    
Sbjct: 178 AETFSLINEFTAHSDFIRSLTVHPTLPYLI-SASDDRKIRVWDW---ENEWRMEQE-FQE 232

Query: 224 HSHFISDVVLS-SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           H+H+I  + ++  D    +SGS DKTL++W L   ++    E H K
Sbjct: 233 HAHYIMQIAVNPEDPEMFVSGSLDKTLKVWKLGEQESICTLEGHEK 278



 Score = 50.8 bits (116), Expect = 8e-07
 Identities = 31/83 (37%), Positives = 45/83 (54%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSS 259
           H  ++ QIA NP+ P+M +S S DKTL VWKL   E+        L GH   ++ V   +
Sbjct: 233 HAHYIMQIAVNPEDPEMFVSGSLDKTLKVWKLGEQESIC-----TLEGHEKGVNCVEFLT 287

Query: 260 DGNYALSGSWDKTLRLWDLAAGK 328
            G   +SGS D ++ +WD+   K
Sbjct: 288 GGR-IVSGSDDCSICVWDIQTQK 309


>Z74030-18|CAA98448.1|  494|Caenorhabditis elegans Hypothetical
           protein D1054.15 protein.
          Length = 494

 Score = 50.8 bits (116), Expect = 8e-07
 Identities = 29/94 (30%), Positives = 48/94 (51%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH   V  ++ +P   D++++ +RD T  VW +      +        GH++ ++DVV  
Sbjct: 266 GHLSAVQALSVHPSL-DVLVTCARDSTARVWDMRTKAQVHCFA-----GHTNTVADVVCQ 319

Query: 257 SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           S     ++ S D T+RLWDLAAG++      H K
Sbjct: 320 SVDPQVITASHDATVRLWDLAAGRSMCTLTHHKK 353



 Score = 44.4 bits (100), Expect = 7e-05
 Identities = 28/99 (28%), Positives = 39/99 (39%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           KL     GH GWV  +   P       S   D+ + +W L       G  +  L GH   
Sbjct: 175 KLYRVASGHTGWVRAVDVEPGN-QWFASGGADRIIKIWDLAS-----GQLKLSLTGHISS 228

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           +  V +S    +  SG  DK ++ WDL   K  R +  H
Sbjct: 229 VRAVKVSPRHPFLFSGGEDKQVKCWDLEYNKVIRHYHGH 267



 Score = 38.7 bits (86), Expect = 0.003
 Identities = 28/118 (23%), Positives = 49/118 (41%)
 Frame = +2

Query: 2   ASGXSSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTR 181
           + G   + K +   S  LKL  +L GH   V  +  +P++P  + S   DK +  W L  
Sbjct: 201 SGGADRIIKIWDLASGQLKL--SLTGHISSVRAVKVSPRHP-FLFSGGEDKQVKCWDL-- 255

Query: 182 DENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
               Y    +  +GH   +  + +    +  ++ + D T R+WD+        F  HT
Sbjct: 256 ---EYNKVIRHYHGHLSAVQALSVHPSLDVLVTCARDSTARVWDMRTKAQVHCFAGHT 310


>Z73970-6|CAA98247.1|  494|Caenorhabditis elegans Hypothetical
           protein D1054.15 protein.
          Length = 494

 Score = 50.8 bits (116), Expect = 8e-07
 Identities = 29/94 (30%), Positives = 48/94 (51%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH   V  ++ +P   D++++ +RD T  VW +      +        GH++ ++DVV  
Sbjct: 266 GHLSAVQALSVHPSL-DVLVTCARDSTARVWDMRTKAQVHCFA-----GHTNTVADVVCQ 319

Query: 257 SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           S     ++ S D T+RLWDLAAG++      H K
Sbjct: 320 SVDPQVITASHDATVRLWDLAAGRSMCTLTHHKK 353



 Score = 44.4 bits (100), Expect = 7e-05
 Identities = 28/99 (28%), Positives = 39/99 (39%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           KL     GH GWV  +   P       S   D+ + +W L       G  +  L GH   
Sbjct: 175 KLYRVASGHTGWVRAVDVEPGN-QWFASGGADRIIKIWDLAS-----GQLKLSLTGHISS 228

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           +  V +S    +  SG  DK ++ WDL   K  R +  H
Sbjct: 229 VRAVKVSPRHPFLFSGGEDKQVKCWDLEYNKVIRHYHGH 267



 Score = 38.7 bits (86), Expect = 0.003
 Identities = 28/118 (23%), Positives = 49/118 (41%)
 Frame = +2

Query: 2   ASGXSSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTR 181
           + G   + K +   S  LKL  +L GH   V  +  +P++P  + S   DK +  W L  
Sbjct: 201 SGGADRIIKIWDLASGQLKL--SLTGHISSVRAVKVSPRHP-FLFSGGEDKQVKCWDL-- 255

Query: 182 DENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
               Y    +  +GH   +  + +    +  ++ + D T R+WD+        F  HT
Sbjct: 256 ---EYNKVIRHYHGHLSAVQALSVHPSLDVLVTCARDSTARVWDMRTKAQVHCFAGHT 310


>AF039711-10|AAB96707.2|  567|Caenorhabditis elegans Yeast prp
           (splicing factor) relatedprotein 17 protein.
          Length = 567

 Score = 50.8 bits (116), Expect = 8e-07
 Identities = 31/97 (31%), Positives = 49/97 (50%), Gaps = 1/97 (1%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLY-GHSH 232
           KL  T RGHN  V  +   PK   + LS S D  + +W++   +        R Y GH  
Sbjct: 266 KLVHTYRGHNKGVNFLQWFPKSAHLFLSCSMDTKIKLWEVYDRQRVV-----RTYAGHKL 320

Query: 233 FISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRF 343
            + +V  +++G   LS S+D+ ++LWD   G+  +RF
Sbjct: 321 PVREVAFNNEGTEFLSASFDRYVKLWDTETGQVKQRF 357



 Score = 31.5 bits (68), Expect = 0.51
 Identities = 20/88 (22%), Positives = 42/88 (47%), Gaps = 4/88 (4%)
 Frame = +2

Query: 101 IATNPKYPD--MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSH--FISDVVLSSDGN 268
           I T  K P+   ++    D  +++++L  D+  +   +K   GH+   +  ++  S D +
Sbjct: 451 IPTMTKSPNDKWVVGQCMDNRIVLFQLVDDKLRFS-KKKAFRGHNAAGYACNIDFSPDQS 509

Query: 269 YALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           + +SG  D  L +WD    K   +++ H
Sbjct: 510 FLISGDADGKLFIWDWRTHKIVGKWKAH 537


>Z73978-3|CAA98293.1|  501|Caenorhabditis elegans Hypothetical
           protein ZC302.2a protein.
          Length = 501

 Score = 50.4 bits (115), Expect = 1e-06
 Identities = 29/94 (30%), Positives = 48/94 (51%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T+RGH  +V   + NP+   +I S+  D+T+ VW         G+  K +  HS  I+ +
Sbjct: 292 TMRGHTNYVFCCSFNPQ-SSLIASAGFDETVRVWDFKT-----GLCVKCIPAHSDPITSI 345

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFED 349
             + DGN   + S+D  +R+WD A+G   +   D
Sbjct: 346 SYNHDGNTMATSSYDGCIRVWDAASGSCLKTLVD 379



 Score = 33.5 bits (73), Expect = 0.13
 Identities = 27/92 (29%), Positives = 39/92 (42%), Gaps = 1/92 (1%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF-ISDVVLS 256
           H+  +T I+ N     M  +SS D  + VW         G   K L    H  ++ V  S
Sbjct: 338 HSDPITSISYNHDGNTMA-TSSYDGCIRVWDAAS-----GSCLKTLVDTDHAPVTFVCFS 391

Query: 257 SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            +G Y LS   D +L+LWD    K  + +  H
Sbjct: 392 PNGKYLLSAQLDSSLKLWDPKKAKPLKYYNGH 423



 Score = 29.5 bits (63), Expect = 2.1
 Identities = 12/35 (34%), Positives = 21/35 (60%)
 Frame = +2

Query: 209 KRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWD 313
           K + GH+  +S +  S  G Y  +GS DK +++W+
Sbjct: 207 KTISGHTKSVSVIKFSYCGKYLGTGSADKQIKVWN 241



 Score = 29.1 bits (62), Expect = 2.7
 Identities = 16/75 (21%), Positives = 35/75 (46%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           I S+S D T+ ++ +       G   + + GH++++     +   +   S  +D+T+R+W
Sbjct: 270 IASASDDTTVKIFDVIS-----GACLRTMRGHTNYVFCCSFNPQSSLIASAGFDETVRVW 324

Query: 311 DLAAGKTTRRFEDHT 355
           D   G   +    H+
Sbjct: 325 DFKTGLCVKCIPAHS 339


>Z79757-3|CAC42307.1|  585|Caenorhabditis elegans Hypothetical
           protein F55B12.3b protein.
          Length = 585

 Score = 49.6 bits (113), Expect = 2e-06
 Identities = 30/95 (31%), Positives = 46/95 (48%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           LRGH   V  I     + D++++ S D TL VW + + E  Y      L GH+  +    
Sbjct: 249 LRGHEDHV--ITCMQIHDDVLVTGSDDNTLKVWCIDKGEVMY-----TLVGHTGGVWTSQ 301

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           +S  G Y +SGS D+T+++W    G      + HT
Sbjct: 302 ISQCGRYIVSGSTDRTVKVWSTVDGSLLHTLQGHT 336



 Score = 39.1 bits (87), Expect = 0.003
 Identities = 28/95 (29%), Positives = 44/95 (46%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL+GH   V  +A       ++++ SRD TL VW +       G     L+GH   +  V
Sbjct: 331 TLQGHTSTVRCMAMAGS---ILVTGSRDTTLRVWDVES-----GRHLATLHGHHAAVRCV 382

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
               DG   +SG +D T+++W+   G+  R    H
Sbjct: 383 QF--DGTTVVSGGYDFTVKIWNAHTGRCIRTLTGH 415



 Score = 32.3 bits (70), Expect = 0.29
 Identities = 21/82 (25%), Positives = 40/82 (48%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH+  V  +  +      ++S   D T+ +W       + G   + L GH++ +  +
Sbjct: 371 TLHGHHAAVRCVQFDGT---TVVSGGYDFTVKIWNA-----HTGRCIRTLTGHNNRVYSL 422

Query: 248 VLSSDGNYALSGSWDKTLRLWD 313
           +  S+ +   SGS D ++R+WD
Sbjct: 423 LFESERSIVCSGSLDTSIRVWD 444


>Z79757-2|CAB02129.2|  587|Caenorhabditis elegans Hypothetical
           protein F55B12.3a protein.
          Length = 587

 Score = 49.6 bits (113), Expect = 2e-06
 Identities = 30/95 (31%), Positives = 46/95 (48%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           LRGH   V  I     + D++++ S D TL VW + + E  Y      L GH+  +    
Sbjct: 251 LRGHEDHV--ITCMQIHDDVLVTGSDDNTLKVWCIDKGEVMY-----TLVGHTGGVWTSQ 303

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           +S  G Y +SGS D+T+++W    G      + HT
Sbjct: 304 ISQCGRYIVSGSTDRTVKVWSTVDGSLLHTLQGHT 338



 Score = 39.1 bits (87), Expect = 0.003
 Identities = 28/95 (29%), Positives = 44/95 (46%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL+GH   V  +A       ++++ SRD TL VW +       G     L+GH   +  V
Sbjct: 333 TLQGHTSTVRCMAMAGS---ILVTGSRDTTLRVWDVES-----GRHLATLHGHHAAVRCV 384

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
               DG   +SG +D T+++W+   G+  R    H
Sbjct: 385 QF--DGTTVVSGGYDFTVKIWNAHTGRCIRTLTGH 417



 Score = 32.3 bits (70), Expect = 0.29
 Identities = 21/82 (25%), Positives = 40/82 (48%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH+  V  +  +      ++S   D T+ +W       + G   + L GH++ +  +
Sbjct: 373 TLHGHHAAVRCVQFDGT---TVVSGGYDFTVKIWNA-----HTGRCIRTLTGHNNRVYSL 424

Query: 248 VLSSDGNYALSGSWDKTLRLWD 313
           +  S+ +   SGS D ++R+WD
Sbjct: 425 LFESERSIVCSGSLDTSIRVWD 446


>Z66561-2|CAA91460.1|  331|Caenorhabditis elegans Hypothetical
           protein F08G12.2 protein.
          Length = 331

 Score = 49.6 bits (113), Expect = 2e-06
 Identities = 27/95 (28%), Positives = 47/95 (49%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH G +   A +P     + +S  D+ +  W +  +  N+      + GHS  + D+ 
Sbjct: 34  LLGHEGEIYTGAFSPD-GTCLATSGYDQKIFFWNVYGECENFST----IKGHSGAVMDLK 88

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            ++D +  +S   DK++R+WD+  G   RRF  HT
Sbjct: 89  FTTDSSSLVSCGTDKSVRVWDMETGTCARRFRTHT 123



 Score = 46.8 bits (106), Expect = 1e-05
 Identities = 24/64 (37%), Positives = 33/64 (51%)
 Frame = +2

Query: 125 DMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLR 304
           D ++S   D  L VW + RDE  Y      L GH   I+ + LS  G + +S S D T+R
Sbjct: 178 DQVISGGIDNVLKVWDMRRDEITY-----TLTGHRDTITGISLSPSGKFIISNSMDCTVR 232

Query: 305 LWDL 316
            WD+
Sbjct: 233 QWDI 236



 Score = 28.3 bits (60), Expect = 4.8
 Identities = 21/93 (22%), Positives = 39/93 (41%)
 Frame = +2

Query: 74  RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
           R H  +V  +  + +   ++ S+S D T  V  +   E     P K  Y + +  + V  
Sbjct: 120 RTHTDFVNAVHPSRRGVTLVASASDDGTCRVHDMRTKE-----PVKT-YTNRYQQTAVTF 173

Query: 254 SSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           +   +  +SG  D  L++WD+   + T     H
Sbjct: 174 NDSSDQVISGGIDNVLKVWDMRRDEITYTLTGH 206


>AF020788-1|AAC47809.1|  587|Caenorhabditis elegans SEL-10 protein.
          Length = 587

 Score = 49.6 bits (113), Expect = 2e-06
 Identities = 30/95 (31%), Positives = 46/95 (48%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           LRGH   V  I     + D++++ S D TL VW + + E  Y      L GH+  +    
Sbjct: 251 LRGHEDHV--ITCMQIHDDVLVTGSDDNTLKVWCIDKGEVMY-----TLVGHTGGVWTSQ 303

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           +S  G Y +SGS D+T+++W    G      + HT
Sbjct: 304 ISQCGRYIVSGSTDRTVKVWSTVDGSLLHTLQGHT 338



 Score = 39.1 bits (87), Expect = 0.003
 Identities = 28/95 (29%), Positives = 44/95 (46%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL+GH   V  +A       ++++ SRD TL VW +       G     L+GH   +  V
Sbjct: 333 TLQGHTSTVRCMAMAGS---ILVTGSRDTTLRVWDVES-----GRHLATLHGHHAAVRCV 384

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
               DG   +SG +D T+++W+   G+  R    H
Sbjct: 385 QF--DGTTVVSGGYDFTVKIWNAHTGRCIRTLTGH 417



 Score = 32.3 bits (70), Expect = 0.29
 Identities = 21/82 (25%), Positives = 40/82 (48%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH+  V  +  +      ++S   D T+ +W       + G   + L GH++ +  +
Sbjct: 373 TLHGHHAAVRCVQFDGT---TVVSGGYDFTVKIWNA-----HTGRCIRTLTGHNNRVYSL 424

Query: 248 VLSSDGNYALSGSWDKTLRLWD 313
           +  S+ +   SGS D ++R+WD
Sbjct: 425 LFESERSIVCSGSLDTSIRVWD 446


>Z68342-4|CAA92776.1| 1000|Caenorhabditis elegans Hypothetical
           protein F38E11.5 protein.
          Length = 1000

 Score = 47.6 bits (108), Expect = 7e-06
 Identities = 27/102 (26%), Positives = 48/102 (47%), Gaps = 2/102 (1%)
 Frame = +2

Query: 59  LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
           ++ +  GH  +V QIA NPK  +   ++S DKT+ VW+         +P   L GH   +
Sbjct: 134 MKQSFEGHTHYVMQIAINPKDNNTFATASLDKTVKVWQF-----GSNVPNFTLEGHEKGV 188

Query: 239 S--DVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           +  D     +  Y +SG+ D  +++WD       +  + H +
Sbjct: 189 NCVDYYHGGEKPYIISGADDHLVKIWDYQNKTCVQTLDGHAQ 230



 Score = 28.7 bits (61), Expect = 3.6
 Identities = 19/60 (31%), Positives = 29/60 (48%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           I+S + D  + +W    D  N    Q  L GH+  +S V    +    ++GS D T+RLW
Sbjct: 202 IISGADDHLVKIW----DYQNKTCVQT-LDGHAQNVSSVCFHPELPLIITGSEDSTVRLW 256


>U28730-7|AAA68258.2|  665|Caenorhabditis elegans Abnormal cell
           lineage protein 23 protein.
          Length = 665

 Score = 47.2 bits (107), Expect = 1e-05
 Identities = 33/103 (32%), Positives = 51/103 (49%)
 Frame = +2

Query: 53  LKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSH 232
           + +R  L GH   V  +  + +Y   I+S+S D+T+ VW +   E       + L GH  
Sbjct: 335 ITIRRVLVGHRAAVNVVDFDDRY---IVSASGDRTIKVWSMDTLEF-----VRTLAGHRR 386

Query: 233 FISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
            I+   L   G   +SGS D T+RLWD+ +G   R  E H ++
Sbjct: 387 GIA--CLQYRGRLVVSGSSDNTIRLWDIHSGVCLRVLEGHEEL 427



 Score = 40.7 bits (91), Expect = 8e-04
 Identities = 24/76 (31%), Positives = 38/76 (50%)
 Frame = +2

Query: 125 DMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLR 304
           D I+S  RD T+ +W    D  +Y    + L GH+  +  + L  D    +SGS D T+R
Sbjct: 233 DKIVSGLRDNTIKIW----DRKDYSC-SRILSGHTGSV--LCLQYDNRVIISGSSDATVR 285

Query: 305 LWDLAAGKTTRRFEDH 352
           +WD+  G+  +    H
Sbjct: 286 VWDVETGECIKTLIHH 301


>AF275253-1|AAG28037.1|  665|Caenorhabditis elegans LIN-23 protein.
          Length = 665

 Score = 47.2 bits (107), Expect = 1e-05
 Identities = 33/103 (32%), Positives = 51/103 (49%)
 Frame = +2

Query: 53  LKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSH 232
           + +R  L GH   V  +  + +Y   I+S+S D+T+ VW +   E       + L GH  
Sbjct: 335 ITIRRVLVGHRAAVNVVDFDDRY---IVSASGDRTIKVWSMDTLEF-----VRTLAGHRR 386

Query: 233 FISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
            I+   L   G   +SGS D T+RLWD+ +G   R  E H ++
Sbjct: 387 GIA--CLQYRGRLVVSGSSDNTIRLWDIHSGVCLRVLEGHEEL 427



 Score = 40.7 bits (91), Expect = 8e-04
 Identities = 24/76 (31%), Positives = 38/76 (50%)
 Frame = +2

Query: 125 DMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLR 304
           D I+S  RD T+ +W    D  +Y    + L GH+  +  + L  D    +SGS D T+R
Sbjct: 233 DKIVSGLRDNTIKIW----DRKDYSC-SRILSGHTGSV--LCLQYDNRVIISGSSDATVR 285

Query: 305 LWDLAAGKTTRRFEDH 352
           +WD+  G+  +    H
Sbjct: 286 VWDVETGECIKTLIHH 301


>Z80215-3|CAB02270.1|  496|Caenorhabditis elegans Hypothetical
           protein C36B1.5 protein.
          Length = 496

 Score = 46.8 bits (106), Expect = 1e-05
 Identities = 27/94 (28%), Positives = 44/94 (46%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH   +  +   P   +MI  SS D ++ VW L    N Y +P      H+  ++ V 
Sbjct: 376 LDGHTKEIHSVEWMPNGYEMITGSS-DNSMKVWDLRMRRNTYTMP-----AHTSVVTRVR 429

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             + G Y +S S+D TL++W     +  R+ + H
Sbjct: 430 ADAAGQYLVSASFDCTLKMWSTTGWQPLRQLQGH 463



 Score = 41.9 bits (94), Expect = 4e-04
 Identities = 18/46 (39%), Positives = 26/46 (56%)
 Frame = +2

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           GHS  ++DV    DG+ AL+G  D   R+WD+  G+     + HTK
Sbjct: 336 GHSKSVADVAFHPDGSVALTGGHDCYGRVWDMRTGRCIMFLDGHTK 381



 Score = 40.7 bits (91), Expect = 8e-04
 Identities = 25/81 (30%), Positives = 42/81 (51%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T+  H   VT++  +      ++S+S D TL +W  T  +     P ++L GH   I  V
Sbjct: 417 TMPAHTSVVTRVRADAA-GQYLVSASFDCTLKMWSTTGWQ-----PLRQLQGHDTRILCV 470

Query: 248 VLSSDGNYALSGSWDKTLRLW 310
            +S DG +  S ++D+T +LW
Sbjct: 471 DISPDGQWMCSSAFDRTFKLW 491



 Score = 39.5 bits (88), Expect = 0.002
 Identities = 28/98 (28%), Positives = 45/98 (45%)
 Frame = +2

Query: 65  GTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISD 244
           G  R H G  TQ   N      ++S S D T+++W L+++      P   L  H   +S 
Sbjct: 250 GCARFHPGAFTQ---NDYSSLNVVSCSYDGTVLLWSLSQES-----PIGELEQHPQRVSK 301

Query: 245 VVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           V    +G++  +  +D T R++DL   K     E H+K
Sbjct: 302 VAFHPNGHHLATACFDSTWRMYDLTTKKELLYQEGHSK 339



 Score = 33.1 bits (72), Expect = 0.17
 Identities = 16/49 (32%), Positives = 25/49 (51%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
           L GH+  I  V    +G   ++GS D ++++WDL   + T     HT V
Sbjct: 376 LDGHTKEIHSVEWMPNGYEMITGSSDNSMKVWDLRMRRNTYTMPAHTSV 424


>AL021487-10|CAA16357.2| 1592|Caenorhabditis elegans Hypothetical
            protein Y45F10B.10 protein.
          Length = 1592

 Score = 46.0 bits (104), Expect = 2e-05
 Identities = 23/82 (28%), Positives = 46/82 (56%)
 Frame = +2

Query: 80   HNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSS 259
            H+  +T  AT+PK  + I + SRD +L +W++ +     G   + L GH + ++   +S 
Sbjct: 1334 HSDEITCFATSPKGGNFIATGSRDMSLKIWQIDK-----GFLTQVLVGHENVVTCCCISF 1388

Query: 260  DGNYALSGSWDKTLRLWDLAAG 325
            D    +SG+ D+ + +W++ +G
Sbjct: 1389 DERLVVSGARDEKIIVWNVQSG 1410



 Score = 30.3 bits (65), Expect = 1.2
 Identities = 13/45 (28%), Positives = 24/45 (53%)
 Frame = +2

Query: 221  GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            GH+  ++ +  S+D +  +S S+DKT+ +W  +    T     HT
Sbjct: 909  GHTAAVTCLCSSNDSSLFVSTSFDKTVNVWVFSQSTPTMSLTHHT 953



 Score = 27.9 bits (59), Expect = 6.3
 Identities = 21/76 (27%), Positives = 33/76 (43%), Gaps = 2/76 (2%)
 Frame = +2

Query: 140  SSRDKTLIVWKLTRDENNYGIPQKRL-YGHSHFISDVVLS-SDGNYALSGSWDKTLRLWD 313
            S  +K + +W    +    G P  R    HS  I+    S   GN+  +GS D +L++W 
Sbjct: 1309 SLSNKEMKIWAFPEE----GPPVTRAKLSHSDEITCFATSPKGGNFIATGSRDMSLKIWQ 1364

Query: 314  LAAGKTTRRFEDHTKV 361
            +  G  T+    H  V
Sbjct: 1365 IDKGFLTQVLVGHENV 1380


>AF106576-4|AAC78176.1|  473|Caenorhabditis elegans Hypothetical
           protein W07E6.2 protein.
          Length = 473

 Score = 45.6 bits (103), Expect = 3e-05
 Identities = 31/87 (35%), Positives = 44/87 (50%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           T K   +LRGH G V Q+A +     +++S S D TL V++L      Y +P     GH 
Sbjct: 391 TGKYLASLRGHVGPVYQVAWSAD-SRLLVSGSADSTLKVFELKTKSLYYDLP-----GHG 444

Query: 230 HFISDVVLSSDGNYALSGSWDKTLRLW 310
             +  V  S +G   +SG  DK L+LW
Sbjct: 445 DEVFTVDWSPEGTKVVSGGKDKVLKLW 471



 Score = 44.0 bits (99), Expect = 9e-05
 Identities = 23/76 (30%), Positives = 36/76 (47%)
 Frame = +2

Query: 125 DMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLR 304
           + ++S S D TL +W     + +      R+ GH   ++ VV S D  Y  S S+DK+++
Sbjct: 330 ERLVSGSDDFTLFMWNPKETKQSIN----RMTGHMQLVNQVVFSPDTRYIASASFDKSVK 385

Query: 305 LWDLAAGKTTRRFEDH 352
           LW    GK       H
Sbjct: 386 LWCGRTGKYLASLRGH 401



 Score = 42.7 bits (96), Expect = 2e-04
 Identities = 30/119 (25%), Positives = 52/119 (43%), Gaps = 4/119 (3%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPD----MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           TL+ H  W+T +A  P + D    ++ S  +D  + +W   +     G   + L GH+  
Sbjct: 185 TLKRHKQWITSLAWQPMHKDPTCRLLASCGKDGNIFIWDTVQ-----GTVVRCLSGHTAS 239

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV*QNS*FC*GVNADYALK 412
           ++ +    +G    SGS D+T+++W    G   R    H            +N DYAL+
Sbjct: 240 VTCLRWGGEG-LIYSGSQDRTVKMWRADDGVMCRNMTGHAHWINTL----ALNTDYALR 293



 Score = 33.9 bits (74), Expect = 0.096
 Identities = 27/90 (30%), Positives = 42/90 (46%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           ET +    + GH   V Q+  +P     I S+S DK++ +W         G     L GH
Sbjct: 348 ETKQSINRMTGHMQLVNQVVFSPD-TRYIASASFDKSVKLWC-----GRTGKYLASLRGH 401

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
              +  V  S+D    +SGS D TL++++L
Sbjct: 402 VGPVYQVAWSADSRLLVSGSADSTLKVFEL 431



 Score = 32.7 bits (71), Expect = 0.22
 Identities = 13/32 (40%), Positives = 18/32 (56%)
 Frame = +2

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           GH   +     S DG    SGS D+T+R+WD+
Sbjct: 103 GHGEPVISAQFSPDGRGLASGSGDQTMRIWDI 134


>AC024200-12|AAF36010.2| 1232|Caenorhabditis elegans Hypothetical
           protein Y71F9AL.17 protein.
          Length = 1232

 Score = 45.6 bits (103), Expect = 3e-05
 Identities = 26/84 (30%), Positives = 45/84 (53%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH  ++     + KYP  I+S+S D+T+ +W   +  N+  I    L GH+H++   
Sbjct: 90  TLLGHLDYIRTTFFHHKYP-WIISASDDQTVRIWNW-QSRNSIAI----LTGHNHYVMCA 143

Query: 248 VLSSDGNYALSGSWDKTLRLWDLA 319
                 +   S S D+T+R+WD++
Sbjct: 144 QFHPTEDLVASASLDQTVRVWDIS 167



 Score = 41.5 bits (93), Expect = 5e-04
 Identities = 27/86 (31%), Positives = 46/86 (53%)
 Frame = +2

Query: 59  LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
           L G  RG N WV    TNP    +++S S D+ + +W+   +   + +   R  GH + +
Sbjct: 203 LEGHDRGVN-WVAFHHTNP----ILVSGSDDRQVKIWRYN-ETKAWELDSCR--GHYNNV 254

Query: 239 SDVVLSSDGNYALSGSWDKTLRLWDL 316
           S V+   + +  LS S DK++R+WD+
Sbjct: 255 SSVIFHPNADLILSNSEDKSIRVWDM 280



 Score = 31.1 bits (67), Expect = 0.67
 Identities = 14/36 (38%), Positives = 23/36 (63%)
 Frame = +2

Query: 74  RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTR 181
           RGH   V+ +  +P   D+ILS+S DK++ VW + +
Sbjct: 248 RGHYNNVSSVIFHPN-ADLILSNSEDKSIRVWDMQK 282


>Z92837-1|CAB07400.1| 1043|Caenorhabditis elegans Hypothetical
           protein R03E1.1 protein.
          Length = 1043

 Score = 43.6 bits (98), Expect = 1e-04
 Identities = 28/83 (33%), Positives = 43/83 (51%), Gaps = 1/83 (1%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L+GH   +  ++ +  Y   ILSS  D+T+ +W L+R+E          + H  F++ V 
Sbjct: 713 LKGHTADILDVSWSKNY--FILSSGMDRTVKLWHLSRNECLC------CFQHIDFVTCVA 764

Query: 251 -LSSDGNYALSGSWDKTLRLWDL 316
            L  D  Y LSGS D  LR+W +
Sbjct: 765 FLPKDDRYFLSGSLDGKLRMWHI 787



 Score = 27.9 bits (59), Expect = 6.3
 Identities = 18/52 (34%), Positives = 28/52 (53%), Gaps = 4/52 (7%)
 Frame = +2

Query: 176 TRDENNYGI----PQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLA 319
           T  ++N G+    P   L GH+  I DV  S +  + LS   D+T++LW L+
Sbjct: 696 TASDDNNGLFCAKPFALLKGHTADILDVSWSKN-YFILSSGMDRTVKLWHLS 746


>AY372076-1|AAQ75758.1| 1043|Caenorhabditis elegans SYM-4 protein.
          Length = 1043

 Score = 43.6 bits (98), Expect = 1e-04
 Identities = 28/83 (33%), Positives = 43/83 (51%), Gaps = 1/83 (1%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L+GH   +  ++ +  Y   ILSS  D+T+ +W L+R+E          + H  F++ V 
Sbjct: 713 LKGHTADILDVSWSKNY--FILSSGMDRTVKLWHLSRNECLC------CFQHIDFVTCVA 764

Query: 251 -LSSDGNYALSGSWDKTLRLWDL 316
            L  D  Y LSGS D  LR+W +
Sbjct: 765 FLPKDDRYFLSGSLDGKLRMWHI 787



 Score = 27.9 bits (59), Expect = 6.3
 Identities = 18/52 (34%), Positives = 28/52 (53%), Gaps = 4/52 (7%)
 Frame = +2

Query: 176 TRDENNYGI----PQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLA 319
           T  ++N G+    P   L GH+  I DV  S +  + LS   D+T++LW L+
Sbjct: 696 TASDDNNGLFCAKPFALLKGHTADILDVSWSKN-YFILSSGMDRTVKLWHLS 746


>Z81097-20|CAB03178.1|  417|Caenorhabditis elegans Hypothetical
           protein K07A1.12 protein.
          Length = 417

 Score = 42.7 bits (96), Expect = 2e-04
 Identities = 28/99 (28%), Positives = 46/99 (46%), Gaps = 4/99 (4%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKR--LYGHSHFISD 244
           L+GH      ++ NP    +ILS+S D+T+  W +  ++N  G  Q +    GH   + D
Sbjct: 168 LKGHTKEGYGLSWNPNKEGLILSASDDQTVCHWDINANQNVAGELQAKDVFKGHESVVED 227

Query: 245 VV--LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           V   +  DG +   G  DK L +WD+         + H+
Sbjct: 228 VAWHVLHDGVFGSVGD-DKKLLIWDVRTSTPGHCIDAHS 265



 Score = 35.5 bits (78), Expect = 0.031
 Identities = 23/89 (25%), Positives = 41/89 (46%), Gaps = 1/89 (1%)
 Frame = +2

Query: 53  LKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSH 232
           L+ +   +GH   V  +A +  +  +  S   DK L++W +         P   +  HS 
Sbjct: 212 LQAKDVFKGHESVVEDVAWHVLHDGVFGSVGDDKKLLIWDV-----RTSTPGHCIDAHSA 266

Query: 233 FISDVVLSSDGNYAL-SGSWDKTLRLWDL 316
            ++ +  +    + L +GS DKT+ LWDL
Sbjct: 267 EVNCLAFNPYSEFILATGSADKTVALWDL 295



 Score = 32.7 bits (71), Expect = 0.22
 Identities = 27/82 (32%), Positives = 38/82 (46%), Gaps = 2/82 (2%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPDMILSS-SRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           H+  V  +A NP Y + IL++ S DKT+ +W    D  N  +       H   I  V  S
Sbjct: 264 HSAEVNCLAFNP-YSEFILATGSADKTVALW----DLRNLRMKLHSFESHRDEIFQVQWS 318

Query: 257 SDGNYALSGS-WDKTLRLWDLA 319
                 L+ S  DK L +WDL+
Sbjct: 319 PHNETILASSGTDKRLHVWDLS 340



 Score = 28.7 bits (61), Expect = 3.6
 Identities = 11/33 (33%), Positives = 18/33 (54%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKL 175
           GH   ++  + NP  P ++ S S D  L VW++
Sbjct: 364 GHTAKISDFSWNPNEPWVVCSVSEDNILQVWQM 396


>AL023833-1|CAA19477.1|  417|Caenorhabditis elegans Hypothetical
           protein K07A1.12 protein.
          Length = 417

 Score = 42.7 bits (96), Expect = 2e-04
 Identities = 28/99 (28%), Positives = 46/99 (46%), Gaps = 4/99 (4%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKR--LYGHSHFISD 244
           L+GH      ++ NP    +ILS+S D+T+  W +  ++N  G  Q +    GH   + D
Sbjct: 168 LKGHTKEGYGLSWNPNKEGLILSASDDQTVCHWDINANQNVAGELQAKDVFKGHESVVED 227

Query: 245 VV--LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           V   +  DG +   G  DK L +WD+         + H+
Sbjct: 228 VAWHVLHDGVFGSVGD-DKKLLIWDVRTSTPGHCIDAHS 265



 Score = 35.5 bits (78), Expect = 0.031
 Identities = 23/89 (25%), Positives = 41/89 (46%), Gaps = 1/89 (1%)
 Frame = +2

Query: 53  LKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSH 232
           L+ +   +GH   V  +A +  +  +  S   DK L++W +         P   +  HS 
Sbjct: 212 LQAKDVFKGHESVVEDVAWHVLHDGVFGSVGDDKKLLIWDV-----RTSTPGHCIDAHSA 266

Query: 233 FISDVVLSSDGNYAL-SGSWDKTLRLWDL 316
            ++ +  +    + L +GS DKT+ LWDL
Sbjct: 267 EVNCLAFNPYSEFILATGSADKTVALWDL 295



 Score = 32.7 bits (71), Expect = 0.22
 Identities = 27/82 (32%), Positives = 38/82 (46%), Gaps = 2/82 (2%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPDMILSS-SRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           H+  V  +A NP Y + IL++ S DKT+ +W    D  N  +       H   I  V  S
Sbjct: 264 HSAEVNCLAFNP-YSEFILATGSADKTVALW----DLRNLRMKLHSFESHRDEIFQVQWS 318

Query: 257 SDGNYALSGS-WDKTLRLWDLA 319
                 L+ S  DK L +WDL+
Sbjct: 319 PHNETILASSGTDKRLHVWDLS 340



 Score = 28.7 bits (61), Expect = 3.6
 Identities = 11/33 (33%), Positives = 18/33 (54%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKL 175
           GH   ++  + NP  P ++ S S D  L VW++
Sbjct: 364 GHTAKISDFSWNPNEPWVVCSVSEDNILQVWQM 396


>AF116530-1|AAD05571.1|  417|Caenorhabditis elegans synthetic
           multivulva protein LIN-53 p48 protein.
          Length = 417

 Score = 42.7 bits (96), Expect = 2e-04
 Identities = 28/99 (28%), Positives = 46/99 (46%), Gaps = 4/99 (4%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKR--LYGHSHFISD 244
           L+GH      ++ NP    +ILS+S D+T+  W +  ++N  G  Q +    GH   + D
Sbjct: 168 LKGHTKEGYGLSWNPNKEGLILSASDDQTVCHWDINANQNVAGELQAKDVFKGHESVVED 227

Query: 245 VV--LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           V   +  DG +   G  DK L +WD+         + H+
Sbjct: 228 VAWHVLHDGVFGSVGD-DKKLLIWDVRTSTPGHCIDAHS 265



 Score = 35.5 bits (78), Expect = 0.031
 Identities = 23/89 (25%), Positives = 41/89 (46%), Gaps = 1/89 (1%)
 Frame = +2

Query: 53  LKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSH 232
           L+ +   +GH   V  +A +  +  +  S   DK L++W +         P   +  HS 
Sbjct: 212 LQAKDVFKGHESVVEDVAWHVLHDGVFGSVGDDKKLLIWDV-----RTSTPGHCIDAHSA 266

Query: 233 FISDVVLSSDGNYAL-SGSWDKTLRLWDL 316
            ++ +  +    + L +GS DKT+ LWDL
Sbjct: 267 EVNCLAFNPYSEFILATGSADKTVALWDL 295



 Score = 32.7 bits (71), Expect = 0.22
 Identities = 27/82 (32%), Positives = 38/82 (46%), Gaps = 2/82 (2%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPDMILSS-SRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           H+  V  +A NP Y + IL++ S DKT+ +W    D  N  +       H   I  V  S
Sbjct: 264 HSAEVNCLAFNP-YSEFILATGSADKTVALW----DLRNLRMKLHSFESHRDEIFQVQWS 318

Query: 257 SDGNYALSGS-WDKTLRLWDLA 319
                 L+ S  DK L +WDL+
Sbjct: 319 PHNETILASSGTDKRLHVWDLS 340



 Score = 28.7 bits (61), Expect = 3.6
 Identities = 11/33 (33%), Positives = 18/33 (54%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKL 175
           GH   ++  + NP  P ++ S S D  L VW++
Sbjct: 364 GHTAKISDFSWNPNEPWVVCSVSEDNILQVWQM 396


>Z47358-8|CAA87433.1|  702|Caenorhabditis elegans Hypothetical
           protein ZK1307.6 protein.
          Length = 702

 Score = 41.1 bits (92), Expect = 6e-04
 Identities = 29/101 (28%), Positives = 46/101 (45%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           T K    L GH+  V  +A N    D I S SRD+T++   +  D+N+ G   ++L  H 
Sbjct: 469 TQKKTRELTGHSSRVGCLAWNA---DTICSGSRDRTIMHRDIRCDDNDMG---RKLTNHR 522

Query: 230 HFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             +  +  S D     SG  D  L +W+L   +  + +  H
Sbjct: 523 QEVCGLKWSPDKQLLASGGNDNQLLVWNLRRNEPIQTYTQH 563



 Score = 33.9 bits (74), Expect = 0.096
 Identities = 13/36 (36%), Positives = 22/36 (61%)
 Frame = +2

Query: 203 PQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           P  +L GH + +  + +S DG   ++G+ D+TLR W
Sbjct: 644 PVTKLVGHQYRVLYLAMSPDGESIVTGAGDETLRFW 679


>AC024770-5|AAK84605.2|  684|Caenorhabditis elegans Hypothetical
           protein Y39H10A.6 protein.
          Length = 684

 Score = 41.1 bits (92), Expect = 6e-04
 Identities = 19/42 (45%), Positives = 24/42 (57%)
 Frame = +2

Query: 62  RGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDE 187
           R +L GH G V  +A NP  P M++S   D T+ VW L R E
Sbjct: 558 RYSLVGHRGHVNAVAWNPADPTMLVSCGADATIRVWSLDRSE 599


>Z99278-1|CAB16490.1|  793|Caenorhabditis elegans Hypothetical
           protein Y53C12B.1 protein.
          Length = 793

 Score = 40.7 bits (91), Expect = 8e-04
 Identities = 23/88 (26%), Positives = 43/88 (48%), Gaps = 6/88 (6%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYG----IPQKRLYGHSHFI 238
           +RGH   V  + +      ++ S S+D ++I W+L     N      +P     GH++ +
Sbjct: 356 IRGHTESVLSVVSPTWDTSLLASCSKDNSIIFWRLVTSPENDSCSTLVPVAAATGHANTV 415

Query: 239 SDVVLSSDGN--YALSGSWDKTLRLWDL 316
           + + +S+ G   +  S S D T++LW L
Sbjct: 416 TALAISNTGRAPFLASVSTDCTIKLWGL 443



 Score = 34.7 bits (76), Expect = 0.055
 Identities = 17/76 (22%), Positives = 36/76 (47%)
 Frame = +2

Query: 128 MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRL 307
           +I +   DK + +W++   +   GI    L GH   + DV  + + +   S S D T+++
Sbjct: 491 LIATGGMDKLVKLWQVDTHKMQLGIAGT-LSGHRRGVGDVKFAKNSHKLASCSGDMTIKI 549

Query: 308 WDLAAGKTTRRFEDHT 355
           W+++     +    H+
Sbjct: 550 WNISEKSCLQTISGHS 565


>Z81490-1|CAB04014.1|  510|Caenorhabditis elegans Hypothetical
           protein CC4.3 protein.
          Length = 510

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 17/45 (37%), Positives = 28/45 (62%)
 Frame = +2

Query: 209 KRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRF 343
           K + GHS +I+DV  S +GN+ +S S D ++R+W   +G+    F
Sbjct: 343 KEMRGHSSYITDVRYSDEGNHIISCSTDGSIRVWHGKSGECLSTF 387



 Score = 29.5 bits (63), Expect = 2.1
 Identities = 20/80 (25%), Positives = 34/80 (42%), Gaps = 4/80 (5%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIP---QKRLYGHSHFISDVVLSSDGNYALSGSWDKTL 301
           ++S S+D  + VW     +    +    Q  L      +  +  S D     +GS D  +
Sbjct: 229 LVSGSKDGFIEVWNYMNGKLRKDLKYQAQDNLMMMDAAVRCISFSRDSEMLATGSIDGKI 288

Query: 302 RLWDLAAGKTTRRFE-DHTK 358
           ++W +  G   RRF+  HTK
Sbjct: 289 KVWKVETGDCLRRFDRAHTK 308



 Score = 29.5 bits (63), Expect = 2.1
 Identities = 18/77 (23%), Positives = 35/77 (45%)
 Frame = +2

Query: 125 DMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLR 304
           +M+ + S D  + VWK+   +      +     H+  +  V  S D ++ LSG  D  +R
Sbjct: 277 EMLATGSIDGKIKVWKVETGDCLRRFDR----AHTKGVCAVRFSKDNSHILSGGNDHVVR 332

Query: 305 LWDLAAGKTTRRFEDHT 355
           +  + +GK  +    H+
Sbjct: 333 VHGMKSGKCLKEMRGHS 349



 Score = 28.7 bits (61), Expect = 3.6
 Identities = 12/27 (44%), Positives = 16/27 (59%)
 Frame = +2

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGK 328
           V S D NY +SGS D  + +W+   GK
Sbjct: 221 VFSPDANYLVSGSKDGFIEVWNYMNGK 247


>AF330595-1|AAK00353.1|  510|Caenorhabditis elegans SMU-1 protein.
          Length = 510

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 17/45 (37%), Positives = 28/45 (62%)
 Frame = +2

Query: 209 KRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRF 343
           K + GHS +I+DV  S +GN+ +S S D ++R+W   +G+    F
Sbjct: 343 KEMRGHSSYITDVRYSDEGNHIISCSTDGSIRVWHGKSGECLSTF 387



 Score = 29.5 bits (63), Expect = 2.1
 Identities = 20/80 (25%), Positives = 34/80 (42%), Gaps = 4/80 (5%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIP---QKRLYGHSHFISDVVLSSDGNYALSGSWDKTL 301
           ++S S+D  + VW     +    +    Q  L      +  +  S D     +GS D  +
Sbjct: 229 LVSGSKDGFIEVWNYMNGKLRKDLKYQAQDNLMMMDAAVRCISFSRDSEMLATGSIDGKI 288

Query: 302 RLWDLAAGKTTRRFE-DHTK 358
           ++W +  G   RRF+  HTK
Sbjct: 289 KVWKVETGDCLRRFDRAHTK 308



 Score = 29.5 bits (63), Expect = 2.1
 Identities = 18/77 (23%), Positives = 35/77 (45%)
 Frame = +2

Query: 125 DMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLR 304
           +M+ + S D  + VWK+   +      +     H+  +  V  S D ++ LSG  D  +R
Sbjct: 277 EMLATGSIDGKIKVWKVETGDCLRRFDR----AHTKGVCAVRFSKDNSHILSGGNDHVVR 332

Query: 305 LWDLAAGKTTRRFEDHT 355
           +  + +GK  +    H+
Sbjct: 333 VHGMKSGKCLKEMRGHS 349



 Score = 28.7 bits (61), Expect = 3.6
 Identities = 12/27 (44%), Positives = 16/27 (59%)
 Frame = +2

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGK 328
           V S D NY +SGS D  + +W+   GK
Sbjct: 221 VFSPDANYLVSGSKDGFIEVWNYMNGK 247


>Z71263-5|CAA95824.1|  356|Caenorhabditis elegans Hypothetical
           protein F52A8.2 protein.
          Length = 356

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 28/110 (25%), Positives = 52/110 (47%), Gaps = 2/110 (1%)
 Frame = +2

Query: 29  PFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQ 208
           P S   + ++ +  +  H  +++   T  +  ++IL+ S D T  +W +   E+   I  
Sbjct: 138 PLSFEDDIIQKKRQVATHTSYMS-CCTFLRSDNLILTGSGDSTCAIWDV---ESGQLI-- 191

Query: 209 KRLYGHSH--FISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           +  +GH+   F  DV     GN  +S   DK   +WD+ +G+  + FE H
Sbjct: 192 QNFHGHTGDVFAIDVPKCDTGNTFISAGADKHSLVWDIRSGQCVQSFEGH 241



 Score = 38.7 bits (86), Expect = 0.003
 Identities = 26/90 (28%), Positives = 41/90 (45%), Gaps = 1/90 (1%)
 Frame = +2

Query: 89  WVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG-HSHFISDVVLSSDG 265
           WV   A +P    MI     D    V  L+ +++   I +KR    H+ ++S        
Sbjct: 112 WVMACAFSPS-SQMIACGGLDNKCSVVPLSFEDDI--IQKKRQVATHTSYMSCCTFLRSD 168

Query: 266 NYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           N  L+GS D T  +WD+ +G+  + F  HT
Sbjct: 169 NLILTGSGDSTCAIWDVESGQLIQNFHGHT 198



 Score = 37.9 bits (84), Expect = 0.006
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           LYGH + IS +  S DG    S SWD T+R+W
Sbjct: 324 LYGHENRISCLRTSPDGTAVCSASWDCTIRIW 355


>AF291847-1|AAK55964.1|  356|Caenorhabditis elegans heterotrimeric G
           protein beta subunit2 protein.
          Length = 356

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 28/110 (25%), Positives = 52/110 (47%), Gaps = 2/110 (1%)
 Frame = +2

Query: 29  PFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQ 208
           P S   + ++ +  +  H  +++   T  +  ++IL+ S D T  +W +   E+   I  
Sbjct: 138 PLSFEDDIIQKKRQVATHTSYMS-CCTFLRSDNLILTGSGDSTCAIWDV---ESGQLI-- 191

Query: 209 KRLYGHSH--FISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           +  +GH+   F  DV     GN  +S   DK   +WD+ +G+  + FE H
Sbjct: 192 QNFHGHTGDVFAIDVPKCDTGNTFISAGADKHSLVWDIRSGQCVQSFEGH 241



 Score = 38.7 bits (86), Expect = 0.003
 Identities = 26/90 (28%), Positives = 41/90 (45%), Gaps = 1/90 (1%)
 Frame = +2

Query: 89  WVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG-HSHFISDVVLSSDG 265
           WV   A +P    MI     D    V  L+ +++   I +KR    H+ ++S        
Sbjct: 112 WVMACAFSPS-SQMIACGGLDNKCSVVPLSFEDDI--IQKKRQVATHTSYMSCCTFLRSD 168

Query: 266 NYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           N  L+GS D T  +WD+ +G+  + F  HT
Sbjct: 169 NLILTGSGDSTCAIWDVESGQLIQNFHGHT 198



 Score = 37.9 bits (84), Expect = 0.006
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           LYGH + IS +  S DG    S SWD T+R+W
Sbjct: 324 LYGHENRISCLRTSPDGTAVCSASWDCTIRIW 355


>Z46242-3|CAA86338.2|  680|Caenorhabditis elegans Hypothetical
           protein F35G12.4b protein.
          Length = 680

 Score = 38.3 bits (85), Expect = 0.004
 Identities = 26/92 (28%), Positives = 44/92 (47%)
 Frame = +2

Query: 41  MSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLY 220
           ++   K    L G    +  +AT P    ++L +  +K +   +L     N  I   +L 
Sbjct: 164 INANFKTVNNLIGCKDSIYSLATTPNL-SLVLGAGTEKCI---RLFDPRTNEKI--MKLR 217

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           GH+  +  +V++ DG  ALS   D T+RLWD+
Sbjct: 218 GHTDNVRALVVNDDGTRALSAGSDATIRLWDI 249


>Z46242-2|CAA86335.2|  683|Caenorhabditis elegans Hypothetical
           protein F35G12.4a protein.
          Length = 683

 Score = 38.3 bits (85), Expect = 0.004
 Identities = 26/92 (28%), Positives = 44/92 (47%)
 Frame = +2

Query: 41  MSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLY 220
           ++   K    L G    +  +AT P    ++L +  +K +   +L     N  I   +L 
Sbjct: 164 INANFKTVNNLIGCKDSIYSLATTPNL-SLVLGAGTEKCI---RLFDPRTNEKI--MKLR 217

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           GH+  +  +V++ DG  ALS   D T+RLWD+
Sbjct: 218 GHTDNVRALVVNDDGTRALSAGSDATIRLWDI 249


>U23412-5|AAK21467.2|  492|Caenorhabditis elegans Hypothetical
           protein T10F2.4 protein.
          Length = 492

 Score = 38.3 bits (85), Expect = 0.004
 Identities = 26/88 (29%), Positives = 44/88 (50%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T +GHN  +  +  +P     I S+S D  + VW  T D ++  I    +  H   ++D+
Sbjct: 246 TFKGHNKKINAVVLHPDNITAI-SASADSHIRVWSAT-DSSSKAI----IDVHQAPVTDI 299

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKT 331
            L++ G+Y LS S D      D+ +GK+
Sbjct: 300 SLNASGDYILSASDDSYWAFSDIRSGKS 327



 Score = 37.1 bits (82), Expect = 0.010
 Identities = 23/87 (26%), Positives = 39/87 (44%), Gaps = 2/87 (2%)
 Frame = +2

Query: 119 YPDMIL--SSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWD 292
           +PD ++  + + D  + +W L         P     GH+  +  +  S +G Y  +GS D
Sbjct: 347 HPDGLIFGTGAADAVVKIWDLKNQTVAAAFP-----GHTAAVRSIAFSENGYYLATGSED 401

Query: 293 KTLRLWDLAAGKTTRRFEDHTKV*QNS 373
             ++LWDL   K  + F +  K   NS
Sbjct: 402 GEVKLWDLRKLKNLKTFANEEKQPINS 428



 Score = 30.3 bits (65), Expect = 1.2
 Identities = 17/62 (27%), Positives = 33/62 (53%)
 Frame = +2

Query: 125 DMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLR 304
           ++ L+   DKT++++   +++       +   GH+  I+ VVL  D   A+S S D  +R
Sbjct: 222 NLSLTGGIDKTVVLYDYEKEQ-----VMQTFKGHNKKINAVVLHPDNITAISASADSHIR 276

Query: 305 LW 310
           +W
Sbjct: 277 VW 278



 Score = 28.7 bits (61), Expect = 3.6
 Identities = 13/36 (36%), Positives = 20/36 (55%)
 Frame = +2

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           L   GN +L+G  DKT+ L+D    +  + F+ H K
Sbjct: 217 LDIKGNLSLTGGIDKTVVLYDYEKEQVMQTFKGHNK 252


>Z81097-15|CAB03172.1|  412|Caenorhabditis elegans Hypothetical
           protein K07A1.11 protein.
          Length = 412

 Score = 37.9 bits (84), Expect = 0.006
 Identities = 26/98 (26%), Positives = 42/98 (42%), Gaps = 3/98 (3%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYG--IPQKRLYGHSHFISD 244
           L+GH G    ++ +      +L++  D  +  W +  ++   G  +PQ +  GHS    D
Sbjct: 167 LKGHEGEGYGMSWSNTREGHLLTAGDDGMICHWDINANQTISGQIVPQSKFKGHSSNAED 226

Query: 245 VVLSSDGNYAL-SGSWDKTLRLWDLAAGKTTRRFEDHT 355
           V   +  N+   S   D+ L LWDL   K       HT
Sbjct: 227 VSFHALHNFVFGSVGDDRKLNLWDLRQSKPQLTAVGHT 264



 Score = 34.7 bits (76), Expect = 0.055
 Identities = 13/38 (34%), Positives = 24/38 (63%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTR 181
           TL+ HN  + Q++ +P Y  ++ SS  D  +IVW +++
Sbjct: 303 TLKHHNDEIFQVSFSPHYETVLASSGSDDRVIVWDISK 340



 Score = 28.7 bits (61), Expect = 3.6
 Identities = 26/86 (30%), Positives = 38/86 (44%), Gaps = 2/86 (2%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T  GH   V  I  NP    ++ + S DKT+ +W    D  N       L  H+  I  V
Sbjct: 259 TAVGHTAEVNCITFNPFSEYILATGSVDKTVALW----DMRNMRKKMYTLKHHNDEIFQV 314

Query: 248 VLSS--DGNYALSGSWDKTLRLWDLA 319
             S   +   A SGS D+ + +WD++
Sbjct: 315 SFSPHYETVLASSGSDDRVI-VWDIS 339



 Score = 28.3 bits (60), Expect = 4.8
 Identities = 13/34 (38%), Positives = 17/34 (50%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLT 178
           GH G V   + NP  P  I SS     L VW+++
Sbjct: 365 GHTGKVADFSWNPNRPWTICSSDEFNALQVWEVS 398


>U53340-3|AAA96208.1|  578|Caenorhabditis elegans Hypothetical
           protein F02E8.5 protein.
          Length = 578

 Score = 37.9 bits (84), Expect = 0.006
 Identities = 30/99 (30%), Positives = 49/99 (49%)
 Frame = +2

Query: 65  GTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISD 244
           GTL G N   T+I         I +SS DK + +W L   +N+  +    L GHS  ++ 
Sbjct: 330 GTLAGSNAAFTRIDYERDRKHFI-ASSNDKNVRIWNL---DNSRLL--STLSGHSDQVTC 383

Query: 245 VVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
           V      + A+SGS D+ +++WD+   + +R     +KV
Sbjct: 384 VKFYQSHS-AVSGSADRVIKIWDIQNQRCSRSLFPASKV 421



 Score = 27.5 bits (58), Expect = 8.3
 Identities = 19/70 (27%), Positives = 36/70 (51%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           +L S+RD T+ +  L   +  +    +  Y  S  +S VVLSS   Y  +GS + ++ +W
Sbjct: 476 LLVSTRDDTISLIDLRTFQTVHCYSAEN-YRTSSDLSRVVLSSGNEYVAAGSSNGSIFVW 534

Query: 311 DLAAGKTTRR 340
           +  + K  ++
Sbjct: 535 NRNSTKLEKQ 544


>AC024867-3|AAK68601.2|  327|Caenorhabditis elegans Eukaryotic
           initiation factor protein3.I protein.
          Length = 327

 Score = 37.9 bits (84), Expect = 0.006
 Identities = 24/86 (27%), Positives = 43/86 (50%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           +L+GH   +T++  N +  D+  S ++DK   VW  T +    G       GH+  + D+
Sbjct: 5   SLKGHERALTRVRFN-REGDLTFSCAKDKKPCVW-YTENGERIGSYD----GHNGAVWDI 58

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAG 325
            +S D    ++ S D T+++WD   G
Sbjct: 59  DVSWDTTKCVTASGDLTVKIWDAELG 84


>Z78413-1|CAB01663.1|  727|Caenorhabditis elegans Hypothetical
           protein T01C3.1 protein.
          Length = 727

 Score = 37.5 bits (83), Expect = 0.008
 Identities = 20/91 (21%), Positives = 41/91 (45%), Gaps = 1/91 (1%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS- 256
           H+G +  +   P+    I+S S D T+  W L  +++      +  +GH   +  +  + 
Sbjct: 92  HDGAIMDVVGVPQKESQIVSISGDSTIRCWDL--NQSTLDRKSQVFFGHEGSVRSICFAP 149

Query: 257 SDGNYALSGSWDKTLRLWDLAAGKTTRRFED 349
            D N  ++G  D  +++WD+      +  ED
Sbjct: 150 DDPNVFVTGGRDFQVKIWDMRVSTVKKMEED 180


>AF039038-7|AAM81098.1|  942|Caenorhabditis elegans Hypothetical
            protein K06A5.8b protein.
          Length = 942

 Score = 37.5 bits (83), Expect = 0.008
 Identities = 23/102 (22%), Positives = 48/102 (47%), Gaps = 1/102 (0%)
 Frame = +2

Query: 50   TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDEN-NYGIPQKRLYGH 226
            T +L  +++GH   +  + T  +  +  +S S+DKT+  W L +    N   P      +
Sbjct: 762  TGQLIQSMKGHTAPILGLYTWSQAGNQFVSCSQDKTIRFWDLRQQTAVNVISPGSNKSHN 821

Query: 227  SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            +  ++ V +  +G   +SG  D ++ L+D+   +  + F  H
Sbjct: 822  ASPVTSVCVDPNGKLLVSGHEDASVALFDIGGNRILQTFRPH 863


>Z66515-12|CAC42333.1|  860|Caenorhabditis elegans Hypothetical
           protein C05C10.6b protein.
          Length = 860

 Score = 37.1 bits (82), Expect = 0.010
 Identities = 25/90 (27%), Positives = 46/90 (51%), Gaps = 1/90 (1%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLY-GHSHFISDVVL 253
           GH   V  +A+ P  P+  LS+S DKT+ +W        +G     ++ GH+  +  +V+
Sbjct: 163 GHTLSVWALASFPDLPNTYLSASADKTIRMW--------FGDTTLSVFKGHTDVVRALVV 214

Query: 254 SSDGNYALSGSWDKTLRLWDLAAGKTTRRF 343
            S  ++  +G+ D  +  WD+A+    R+F
Sbjct: 215 LSSSHFLSAGN-DGHIIHWDVASASILRKF 243


>Z66515-11|CAA91354.1|  858|Caenorhabditis elegans Hypothetical
           protein C05C10.6a protein.
          Length = 858

 Score = 37.1 bits (82), Expect = 0.010
 Identities = 25/90 (27%), Positives = 46/90 (51%), Gaps = 1/90 (1%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLY-GHSHFISDVVL 253
           GH   V  +A+ P  P+  LS+S DKT+ +W        +G     ++ GH+  +  +V+
Sbjct: 161 GHTLSVWALASFPDLPNTYLSASADKTIRMW--------FGDTTLSVFKGHTDVVRALVV 212

Query: 254 SSDGNYALSGSWDKTLRLWDLAAGKTTRRF 343
            S  ++  +G+ D  +  WD+A+    R+F
Sbjct: 213 LSSSHFLSAGN-DGHIIHWDVASASILRKF 241


>Z49127-9|CAA88948.1|  340|Caenorhabditis elegans Hypothetical
           protein F13D12.7 protein.
          Length = 340

 Score = 37.1 bits (82), Expect = 0.010
 Identities = 24/91 (26%), Positives = 37/91 (40%)
 Frame = +2

Query: 83  NGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSD 262
           + WV   A  P     +     D    ++ L   E N  +  + L GH+ ++S      D
Sbjct: 97  SSWVMTCAYAPS-GSFVACGGLDNICSIYSLKTREGNVRV-SRELPGHTGYLSCCRFLDD 154

Query: 263 GNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            N  ++ S D T  LWD+  G+    F  HT
Sbjct: 155 -NQIVTSSGDMTCALWDIETGQQCTAFTGHT 184



 Score = 36.7 bits (81), Expect = 0.014
 Identities = 26/82 (31%), Positives = 41/82 (50%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH G V  ++ +P +   I S + D +  +W + RD    G+ ++   GH   I+ V   
Sbjct: 182 GHTGDVMSLSLSPDFRTFI-SGACDASAKLWDI-RD----GMCKQTFPGHESDINAVAFF 235

Query: 257 SDGNYALSGSWDKTLRLWDLAA 322
             GN   +GS D T RL+D+ A
Sbjct: 236 PSGNAFATGSDDATCRLFDIRA 257



 Score = 36.3 bits (80), Expect = 0.018
 Identities = 24/94 (25%), Positives = 42/94 (44%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH G+++         + I++SS D T  +W +   +           GH+  +  + 
Sbjct: 139 LPGHTGYLS--CCRFLDDNQIVTSSGDMTCALWDIETGQQCTAFT-----GHTGDVMSLS 191

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           LS D    +SG+ D + +LWD+  G   + F  H
Sbjct: 192 LSPDFRTFISGACDASAKLWDIRDGMCKQTFPGH 225



 Score = 33.5 bits (73), Expect = 0.13
 Identities = 21/74 (28%), Positives = 37/74 (50%)
 Frame = +2

Query: 92  VTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNY 271
           +T +A + K   ++ +   D    VW   R E   G+    L GH + +S + ++ DG  
Sbjct: 273 ITSVAFS-KSGRLLFAGYDDFNCNVWDSMRQERA-GV----LAGHDNRVSCLGVTEDGMA 326

Query: 272 ALSGSWDKTLRLWD 313
             +GSWD  L++W+
Sbjct: 327 VCTGSWDSFLKIWN 340


>Z48178-11|CAC42247.1|  860|Caenorhabditis elegans Hypothetical
           protein C05C10.6b protein.
          Length = 860

 Score = 37.1 bits (82), Expect = 0.010
 Identities = 25/90 (27%), Positives = 46/90 (51%), Gaps = 1/90 (1%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLY-GHSHFISDVVL 253
           GH   V  +A+ P  P+  LS+S DKT+ +W        +G     ++ GH+  +  +V+
Sbjct: 163 GHTLSVWALASFPDLPNTYLSASADKTIRMW--------FGDTTLSVFKGHTDVVRALVV 214

Query: 254 SSDGNYALSGSWDKTLRLWDLAAGKTTRRF 343
            S  ++  +G+ D  +  WD+A+    R+F
Sbjct: 215 LSSSHFLSAGN-DGHIIHWDVASASILRKF 243


>Z48178-10|CAA88206.1|  858|Caenorhabditis elegans Hypothetical
           protein C05C10.6a protein.
          Length = 858

 Score = 37.1 bits (82), Expect = 0.010
 Identities = 25/90 (27%), Positives = 46/90 (51%), Gaps = 1/90 (1%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLY-GHSHFISDVVL 253
           GH   V  +A+ P  P+  LS+S DKT+ +W        +G     ++ GH+  +  +V+
Sbjct: 161 GHTLSVWALASFPDLPNTYLSASADKTIRMW--------FGDTTLSVFKGHTDVVRALVV 212

Query: 254 SSDGNYALSGSWDKTLRLWDLAAGKTTRRF 343
            S  ++  +G+ D  +  WD+A+    R+F
Sbjct: 213 LSSSHFLSAGN-DGHIIHWDVASASILRKF 241


>X17497-1|CAA35532.1|  340|Caenorhabditis elegans G-protein protein.
          Length = 340

 Score = 37.1 bits (82), Expect = 0.010
 Identities = 24/91 (26%), Positives = 37/91 (40%)
 Frame = +2

Query: 83  NGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSD 262
           + WV   A  P     +     D    ++ L   E N  +  + L GH+ ++S      D
Sbjct: 97  SSWVMTCAYAPS-GSFVACGGLDNICSIYSLKTREGNVRV-SRELPGHTGYLSCCRFLDD 154

Query: 263 GNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            N  ++ S D T  LWD+  G+    F  HT
Sbjct: 155 -NQIVTSSGDMTCALWDIETGQQCTAFTGHT 184



 Score = 36.7 bits (81), Expect = 0.014
 Identities = 26/82 (31%), Positives = 41/82 (50%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH G V  ++ +P +   I S + D +  +W + RD    G+ ++   GH   I+ V   
Sbjct: 182 GHTGDVMSLSLSPDFRTFI-SGACDASAKLWDI-RD----GMCKQTFPGHESDINAVAFF 235

Query: 257 SDGNYALSGSWDKTLRLWDLAA 322
             GN   +GS D T RL+D+ A
Sbjct: 236 PSGNRFATGSDDATCRLFDIRA 257



 Score = 36.3 bits (80), Expect = 0.018
 Identities = 24/94 (25%), Positives = 42/94 (44%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH G+++         + I++SS D T  +W +   +           GH+  +  + 
Sbjct: 139 LPGHTGYLS--CCRFLDDNQIVTSSGDMTCALWDIETGQQCTAFT-----GHTGDVMSLS 191

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           LS D    +SG+ D + +LWD+  G   + F  H
Sbjct: 192 LSPDFRTFISGACDASAKLWDIRDGMCKQTFPGH 225



 Score = 33.5 bits (73), Expect = 0.13
 Identities = 21/74 (28%), Positives = 37/74 (50%)
 Frame = +2

Query: 92  VTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNY 271
           +T +A + K   ++ +   D    VW   R E   G+    L GH + +S + ++ DG  
Sbjct: 273 ITSVAFS-KSGRLLFAGYDDFNCNVWDSMRQERA-GV----LAGHDNRVSCLGVTEDGMA 326

Query: 272 ALSGSWDKTLRLWD 313
             +GSWD  L++W+
Sbjct: 327 VCTGSWDSFLKIWN 340


>AF291846-1|AAK55963.1|  340|Caenorhabditis elegans heterotrimeric G
           protein beta subunit1 protein.
          Length = 340

 Score = 37.1 bits (82), Expect = 0.010
 Identities = 24/91 (26%), Positives = 37/91 (40%)
 Frame = +2

Query: 83  NGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSD 262
           + WV   A  P     +     D    ++ L   E N  +  + L GH+ ++S      D
Sbjct: 97  SSWVMTCAYAPS-GSFVACGGLDNICSIYSLKTREGNVRV-SRELPGHTGYLSCCRFLDD 154

Query: 263 GNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            N  ++ S D T  LWD+  G+    F  HT
Sbjct: 155 -NQIVTSSGDMTCALWDIETGQQCTAFTGHT 184



 Score = 36.7 bits (81), Expect = 0.014
 Identities = 26/82 (31%), Positives = 41/82 (50%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH G V  ++ +P +   I S + D +  +W + RD    G+ ++   GH   I+ V   
Sbjct: 182 GHTGDVMSLSLSPDFRTFI-SGACDASAKLWDI-RD----GMCKQTFPGHESDINAVAFF 235

Query: 257 SDGNYALSGSWDKTLRLWDLAA 322
             GN   +GS D T RL+D+ A
Sbjct: 236 PSGNAFATGSDDATCRLFDIRA 257



 Score = 36.3 bits (80), Expect = 0.018
 Identities = 24/94 (25%), Positives = 42/94 (44%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH G+++         + I++SS D T  +W +   +           GH+  +  + 
Sbjct: 139 LPGHTGYLS--CCRFLDDNQIVTSSGDMTCALWDIETGQQCTAFT-----GHTGDVMSLS 191

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           LS D    +SG+ D + +LWD+  G   + F  H
Sbjct: 192 LSPDFRTFISGACDASAKLWDIRDGMCKQTFPGH 225



 Score = 33.5 bits (73), Expect = 0.13
 Identities = 21/74 (28%), Positives = 37/74 (50%)
 Frame = +2

Query: 92  VTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNY 271
           +T +A + K   ++ +   D    VW   R E   G+    L GH + +S + ++ DG  
Sbjct: 273 ITSVAFS-KSGRLLFAGYDDFNCNVWDSMRQERA-GV----LAGHDNRVSCLGVTEDGMA 326

Query: 272 ALSGSWDKTLRLWD 313
             +GSWD  L++W+
Sbjct: 327 VCTGSWDSFLKIWN 340


>AF047651-2|AAL13318.1|  486|Caenorhabditis elegans Hypothetical
           protein C05D2.10b protein.
          Length = 486

 Score = 36.7 bits (81), Expect = 0.014
 Identities = 16/57 (28%), Positives = 26/57 (45%)
 Frame = +2

Query: 182 DENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           D +   +P  RL GH   +S     + G   ++ SWD+T  +WD+  G+       H
Sbjct: 265 DGHRIRVPVMRLTGHRAPVSCCEWLAGGQQMVTASWDRTANVWDVEKGEVVNILSGH 321



 Score = 33.9 bits (74), Expect = 0.096
 Identities = 18/59 (30%), Positives = 27/59 (45%)
 Frame = +2

Query: 179 RDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           RD + + +  + L GH   +  V   S  N   S S D+T R+W L +G     +  HT
Sbjct: 125 RDGSKFRL-SRLLEGHKDGVWHVAADSTRNICASASADQTARIWSLESGACLATYTGHT 182



 Score = 29.9 bits (64), Expect = 1.6
 Identities = 26/94 (27%), Positives = 42/94 (44%), Gaps = 1/94 (1%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           ++++S D+T  VW + + E         L GH   ++     S+    L+ S D T RLW
Sbjct: 295 MVTASWDRTANVWDVEKGE-----VVNILSGHESELNHCSTHSNQKLVLTSSKDSTFRLW 349

Query: 311 DL-AAGKTTRRFEDHTKV*QNS*FC*GVNADYAL 409
           D   A ++   F+ H    Q+S      N DY +
Sbjct: 350 DFREAIQSVAVFQGH----QDSVTSVSFNTDYRI 379


>AF047651-1|AAK67207.1|  484|Caenorhabditis elegans Hypothetical
           protein C05D2.10a protein.
          Length = 484

 Score = 36.7 bits (81), Expect = 0.014
 Identities = 16/57 (28%), Positives = 26/57 (45%)
 Frame = +2

Query: 182 DENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           D +   +P  RL GH   +S     + G   ++ SWD+T  +WD+  G+       H
Sbjct: 263 DGHRIRVPVMRLTGHRAPVSCCEWLAGGQQMVTASWDRTANVWDVEKGEVVNILSGH 319



 Score = 33.9 bits (74), Expect = 0.096
 Identities = 18/59 (30%), Positives = 27/59 (45%)
 Frame = +2

Query: 179 RDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           RD + + +  + L GH   +  V   S  N   S S D+T R+W L +G     +  HT
Sbjct: 123 RDGSKFRL-SRLLEGHKDGVWHVAADSTRNICASASADQTARIWSLESGACLATYTGHT 180



 Score = 29.9 bits (64), Expect = 1.6
 Identities = 26/94 (27%), Positives = 42/94 (44%), Gaps = 1/94 (1%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           ++++S D+T  VW + + E         L GH   ++     S+    L+ S D T RLW
Sbjct: 293 MVTASWDRTANVWDVEKGE-----VVNILSGHESELNHCSTHSNQKLVLTSSKDSTFRLW 347

Query: 311 DL-AAGKTTRRFEDHTKV*QNS*FC*GVNADYAL 409
           D   A ++   F+ H    Q+S      N DY +
Sbjct: 348 DFREAIQSVAVFQGH----QDSVTSVSFNTDYRI 377


>AF040652-5|AAB95022.2|  378|Caenorhabditis elegans Hypothetical
           protein T05A8.5 protein.
          Length = 378

 Score = 36.7 bits (81), Expect = 0.014
 Identities = 20/69 (28%), Positives = 37/69 (53%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           ++++ R+ TL  W    +  +  +P     GH   ++ VV S + N  +SGS D ++++W
Sbjct: 113 LIAAGRNGTLTHWMFNHEPGD--LPNVVFDGHKFGVTGVV-SINENQFMSGSRDCSVKIW 169

Query: 311 DLAAGKTTR 337
           DL + K  R
Sbjct: 170 DLESAKCVR 178


>U42835-5|AAO61444.1|  517|Caenorhabditis elegans Uncoordinated
           protein 78, isoform b protein.
          Length = 517

 Score = 36.3 bits (80), Expect = 0.018
 Identities = 25/105 (23%), Positives = 47/105 (44%), Gaps = 3/105 (2%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQK---RLYGH 226
           K + T   H  +V  +  NP    +  S+  D T++++    D    G+ +    +   H
Sbjct: 181 KFKSTFGEHTKFVHSVRYNPD-GSLFASTGGDGTIVLYNGV-DGTKTGVFEDDSLKNVAH 238

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
           S  +  +  S DG    S S DKT+++W++A  K  +     T++
Sbjct: 239 SGSVFGLTWSPDGTKIASASADKTIKIWNVATLKVEKTIPVGTRI 283



 Score = 31.9 bits (69), Expect = 0.39
 Identities = 14/44 (31%), Positives = 23/44 (52%)
 Frame = +2

Query: 218 YGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFED 349
           YGH+  I+ +  S+DG    S   +  +  WD++ G + R F D
Sbjct: 321 YGHNKAITALSSSADGKTLFSADAEGHINSWDISTGISNRVFPD 364


>U42835-4|AAA83588.1|  611|Caenorhabditis elegans Uncoordinated
           protein 78, isoform a protein.
          Length = 611

 Score = 36.3 bits (80), Expect = 0.018
 Identities = 25/105 (23%), Positives = 47/105 (44%), Gaps = 3/105 (2%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQK---RLYGH 226
           K + T   H  +V  +  NP    +  S+  D T++++    D    G+ +    +   H
Sbjct: 181 KFKSTFGEHTKFVHSVRYNPD-GSLFASTGGDGTIVLYNGV-DGTKTGVFEDDSLKNVAH 238

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
           S  +  +  S DG    S S DKT+++W++A  K  +     T++
Sbjct: 239 SGSVFGLTWSPDGTKIASASADKTIKIWNVATLKVEKTIPVGTRI 283



 Score = 31.9 bits (69), Expect = 0.39
 Identities = 14/44 (31%), Positives = 23/44 (52%)
 Frame = +2

Query: 218 YGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFED 349
           YGH+  I+ +  S+DG    S   +  +  WD++ G + R F D
Sbjct: 321 YGHNKAITALSSSADGKTLFSADAEGHINSWDISTGISNRVFPD 364


>U23139-7|AAK31492.1|  929|Caenorhabditis elegans Hypothetical
           protein F13H8.2 protein.
          Length = 929

 Score = 36.3 bits (80), Expect = 0.018
 Identities = 18/58 (31%), Positives = 30/58 (51%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV*QNS*FC*G 388
           LYGHS  ++ V ++      ++GS DK++++W L  G   + F  H     +  FC G
Sbjct: 582 LYGHSLPVTCVDIAPSSKLCVTGSVDKSVKVWGLDFGDCHKSFHAHDDAVTSVLFCPG 639



 Score = 31.1 bits (67), Expect = 0.67
 Identities = 19/61 (31%), Positives = 26/61 (42%)
 Frame = +2

Query: 170 KLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFED 349
           KL   EN    P     GH   ++ +  SSDG    +G  D  + LWD+ A +   R   
Sbjct: 85  KLFNQENEDSEPIM-FSGHKKAVNCIEFSSDGLLFATGGKDGVIVLWDILAERGMFRLHG 143

Query: 350 H 352
           H
Sbjct: 144 H 144



 Score = 29.5 bits (63), Expect = 2.1
 Identities = 11/65 (16%), Positives = 30/65 (46%)
 Frame = +2

Query: 128 MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRL 307
           +  +  +D  +++W +  +   +     RL+GH   ++ +       + +S S D  ++ 
Sbjct: 117 LFATGGKDGVIVLWDILAERGMF-----RLHGHKESVTQMKFVRGDRFIISTSKDSLIKF 171

Query: 308 WDLAA 322
           W +A+
Sbjct: 172 WSIAS 176


>AF324437-1|AAK11613.1|  611|Caenorhabditis elegans UNC-78 protein.
          Length = 611

 Score = 36.3 bits (80), Expect = 0.018
 Identities = 25/105 (23%), Positives = 47/105 (44%), Gaps = 3/105 (2%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQK---RLYGH 226
           K + T   H  +V  +  NP    +  S+  D T++++    D    G+ +    +   H
Sbjct: 181 KFKSTFGEHTKFVHSVRYNPD-GSLFASTGGDGTIVLYNGV-DGTKTGVFEDDSLKNVAH 238

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
           S  +  +  S DG    S S DKT+++W++A  K  +     T++
Sbjct: 239 SGSVFGLTWSPDGTKIASASADKTIKIWNVATLKVEKTIPVGTRI 283



 Score = 31.9 bits (69), Expect = 0.39
 Identities = 14/44 (31%), Positives = 23/44 (52%)
 Frame = +2

Query: 218 YGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFED 349
           YGH+  I+ +  S+DG    S   +  +  WD++ G + R F D
Sbjct: 321 YGHNKAITALSSSADGKTLFSADAEGHINSWDISTGISNRVFPD 364


>Z73906-10|CAB54209.1|  530|Caenorhabditis elegans Hypothetical
           protein D2030.9b protein.
          Length = 530

 Score = 35.9 bits (79), Expect = 0.024
 Identities = 22/87 (25%), Positives = 37/87 (42%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           ++R  +  H   V  +       ++I S+  D  + VW      +    P     GH   
Sbjct: 261 RIRTIVNAHEDDVNSVCFADLGSNLIYSAGDDGLVKVWDKRAWSDGDVEPVGVFAGHRDG 320

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDL 316
           ++ V    D  Y LS S D+T+++WDL
Sbjct: 321 VTHVDSRQDERYLLSNSKDQTIKVWDL 347



 Score = 31.1 bits (67), Expect = 0.67
 Identities = 16/50 (32%), Positives = 25/50 (50%)
 Frame = +2

Query: 65  GTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKR 214
           G   GH   VT + +       +LS+S+D+T+ VW L +  N  G+   R
Sbjct: 312 GVFAGHRDGVTHVDSRQD-ERYLLSNSKDQTIKVWDLRKFSNMSGVEATR 360


>Z73906-9|CAA98121.1|  571|Caenorhabditis elegans Hypothetical
           protein D2030.9a protein.
          Length = 571

 Score = 35.9 bits (79), Expect = 0.024
 Identities = 22/87 (25%), Positives = 37/87 (42%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           ++R  +  H   V  +       ++I S+  D  + VW      +    P     GH   
Sbjct: 302 RIRTIVNAHEDDVNSVCFADLGSNLIYSAGDDGLVKVWDKRAWSDGDVEPVGVFAGHRDG 361

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDL 316
           ++ V    D  Y LS S D+T+++WDL
Sbjct: 362 VTHVDSRQDERYLLSNSKDQTIKVWDL 388



 Score = 31.1 bits (67), Expect = 0.67
 Identities = 16/50 (32%), Positives = 25/50 (50%)
 Frame = +2

Query: 65  GTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKR 214
           G   GH   VT + +       +LS+S+D+T+ VW L +  N  G+   R
Sbjct: 353 GVFAGHRDGVTHVDSRQD-ERYLLSNSKDQTIKVWDLRKFSNMSGVEATR 401


>Z71181-10|CAA94901.2|  678|Caenorhabditis elegans Hypothetical
           protein K07C5.8 protein.
          Length = 678

 Score = 35.9 bits (79), Expect = 0.024
 Identities = 22/89 (24%), Positives = 42/89 (47%)
 Frame = +2

Query: 92  VTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNY 271
           + +I ++P  P + L    D+T+  +    D  N  I  + +  H   +S + +  +G Y
Sbjct: 561 MNKIVSHPTMP-LTLIGGEDRTIRYF----DNTNGSIIHEAI-AHVEGVSSLAIDPNGLY 614

Query: 272 ALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
            LSGS D ++R+W++      +    H K
Sbjct: 615 LLSGSHDGSIRMWNMEKRSCLQEISAHRK 643



 Score = 31.1 bits (67), Expect = 0.67
 Identities = 24/93 (25%), Positives = 40/93 (43%), Gaps = 6/93 (6%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTR------DENNYGIPQKRLYGHS 229
           T RGH G V  +  +P   D + +   D  +  + +        D  +  +  + L GH+
Sbjct: 408 TFRGHKGPVLCLVLSPT-GDHLYTGGIDGNICCFNVPSSNGDPFDSYDPRVLTETLTGHT 466

Query: 230 HFISDVVLSSDGNYALSGSWDKTLRLWDLAAGK 328
             I  V   S  +  +S S D T+RLW+   G+
Sbjct: 467 DAIWSVAYHSSNSRLVSASSDSTVRLWEPGNGE 499


>Z71177-11|CAA94873.2|  678|Caenorhabditis elegans Hypothetical
           protein K07C5.8 protein.
          Length = 678

 Score = 35.9 bits (79), Expect = 0.024
 Identities = 22/89 (24%), Positives = 42/89 (47%)
 Frame = +2

Query: 92  VTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNY 271
           + +I ++P  P + L    D+T+  +    D  N  I  + +  H   +S + +  +G Y
Sbjct: 561 MNKIVSHPTMP-LTLIGGEDRTIRYF----DNTNGSIIHEAI-AHVEGVSSLAIDPNGLY 614

Query: 272 ALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
            LSGS D ++R+W++      +    H K
Sbjct: 615 LLSGSHDGSIRMWNMEKRSCLQEISAHRK 643



 Score = 31.1 bits (67), Expect = 0.67
 Identities = 24/93 (25%), Positives = 40/93 (43%), Gaps = 6/93 (6%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTR------DENNYGIPQKRLYGHS 229
           T RGH G V  +  +P   D + +   D  +  + +        D  +  +  + L GH+
Sbjct: 408 TFRGHKGPVLCLVLSPT-GDHLYTGGIDGNICCFNVPSSNGDPFDSYDPRVLTETLTGHT 466

Query: 230 HFISDVVLSSDGNYALSGSWDKTLRLWDLAAGK 328
             I  V   S  +  +S S D T+RLW+   G+
Sbjct: 467 DAIWSVAYHSSNSRLVSASSDSTVRLWEPGNGE 499


>U80447-3|AAB37807.2|  910|Caenorhabditis elegans Hypothetical
           protein F55F8.3 protein.
          Length = 910

 Score = 35.9 bits (79), Expect = 0.024
 Identities = 14/34 (41%), Positives = 23/34 (67%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           L GH   IS + +   GN+ +SGSWD+T+++W +
Sbjct: 484 LSGHESAISSIDIH--GNHIVSGSWDRTIKMWTI 515



 Score = 31.1 bits (67), Expect = 0.67
 Identities = 18/66 (27%), Positives = 35/66 (53%)
 Frame = +2

Query: 158 LIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTR 337
           L+VW+   +  +Y + Q+    HS  I+    S DG+   +G+ D  +++W+  +   T 
Sbjct: 342 LVVWEWQSE--SYVMKQQ---AHSLRITTAEYSPDGSLMATGAEDGKVKIWNSRSSFCTV 396

Query: 338 RFEDHT 355
            F++HT
Sbjct: 397 TFDEHT 402


>U80447-5|AAB37809.1|  439|Caenorhabditis elegans Temporarily
           assigned gene nameprotein 345 protein.
          Length = 439

 Score = 35.5 bits (78), Expect = 0.031
 Identities = 16/44 (36%), Positives = 24/44 (54%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFE 346
           L GH   +  V ++SD   A+SGS D  L++W+L A      +E
Sbjct: 207 LRGHERAVECVSVNSDSTRAISGSVDTNLKIWNLDASDEATTYE 250



 Score = 34.3 bits (75), Expect = 0.072
 Identities = 25/84 (29%), Positives = 43/84 (51%), Gaps = 3/84 (3%)
 Frame = +2

Query: 77  GH-NGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
           GH NGWV  +  NP   +  +S S DKT  +W +   +++       ++GH     D +L
Sbjct: 364 GHQNGWVEAVKWNPLDTNQFVSVSTDKTAKMWDVRSSKSSL----FDIHGH----DDRIL 415

Query: 254 SSDGNYAL--SGSWDKTLRLWDLA 319
            +  N  L  +GS D T+++++ A
Sbjct: 416 CATWNEGLIATGSADCTIKIFETA 439



 Score = 30.7 bits (66), Expect = 0.89
 Identities = 25/83 (30%), Positives = 44/83 (53%), Gaps = 3/83 (3%)
 Frame = +2

Query: 95  TQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLY-GHSHFISDVVLSS--DG 265
           T I  +PK  D+++SS  D    + +L   +N  G   K+ + GH +   + V  +  D 
Sbjct: 325 TSIDLHPK-SDLLISSCTDA---IPRLYDPKNRDGSMVKQSFIGHQNGWVEAVKWNPLDT 380

Query: 266 NYALSGSWDKTLRLWDLAAGKTT 334
           N  +S S DKT ++WD+ + K++
Sbjct: 381 NQFVSVSTDKTAKMWDVRSSKSS 403



 Score = 30.3 bits (65), Expect = 1.2
 Identities = 19/58 (32%), Positives = 28/58 (48%), Gaps = 2/58 (3%)
 Frame = +2

Query: 170 KLTRDENNYGIPQKRLYGHSHFISDVVLSS-DGNYALSGSWDKTLRLWDL-AAGKTTR 337
           K  + E    +P   + GH   +S V     +  +A S SWD T+  WDL  AG+ +R
Sbjct: 260 KRRKKETKTKVPMVTIGGHRDKVSAVEWCPWNSGHAFSCSWDHTIVEWDLELAGEISR 317


>U42833-5|AAA83580.1|  444|Caenorhabditis elegans Hypothetical
           protein ZK430.7 protein.
          Length = 444

 Score = 35.5 bits (78), Expect = 0.031
 Identities = 22/90 (24%), Positives = 41/90 (45%), Gaps = 1/90 (1%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           +L GH   V  +A +P  P  + S +RD  + +W L   E      Q  L  H   ++D+
Sbjct: 61  SLDGHVDGVQVLAKHPNRPSTVFSGARDGQVKIWNLASRE-----CQATLDAHRGLVNDI 115

Query: 248 VL-SSDGNYALSGSWDKTLRLWDLAAGKTT 334
            + +++G   ++   D  L+ W +   + T
Sbjct: 116 SIDNNNGENFVTVGQDNQLKYWKIEGQQKT 145


>U88311-6|AAB42347.1|  382|Caenorhabditis elegans Hypothetical
           protein C10H11.8 protein.
          Length = 382

 Score = 35.1 bits (77), Expect = 0.041
 Identities = 12/39 (30%), Positives = 22/39 (56%)
 Frame = +2

Query: 242 DVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           D + SS+G Y  +G  D  +++WD+   K   +++ H K
Sbjct: 330 DAIFSSEGRYIFTGGNDNQVKIWDVENNKKVAQWDGHIK 368



 Score = 27.5 bits (58), Expect = 8.3
 Identities = 10/18 (55%), Positives = 14/18 (77%)
 Frame = +2

Query: 275 LSGSWDKTLRLWDLAAGK 328
           +S S+D T+RLW L+ GK
Sbjct: 55  VSASYDLTIRLWQLSTGK 72


>U42438-1|AAN84876.1|  459|Caenorhabditis elegans Maternal effect
           sterile protein 6 protein.
          Length = 459

 Score = 35.1 bits (77), Expect = 0.041
 Identities = 28/97 (28%), Positives = 46/97 (47%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           KL   LR     +  I T P   ++I+ +S D+++ +  + R+E    I    L  H+  
Sbjct: 139 KLSNRLRSVGWEINDIRTCPANSNLIVCASSDQSIRIHHI-RNEACL-IVIGGLECHAGT 196

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFE 346
           I  V  S+DG++ LS  +D  L  WDL+  +     E
Sbjct: 197 ILSVDWSTDGDFILSCGFDHQLMEWDLSVKQVKEHLE 233


>AF016224-1|AAC27121.1|  459|Caenorhabditis elegans WD-40 repeat
           protein protein.
          Length = 459

 Score = 35.1 bits (77), Expect = 0.041
 Identities = 28/97 (28%), Positives = 46/97 (47%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           KL   LR     +  I T P   ++I+ +S D+++ +  + R+E    I    L  H+  
Sbjct: 139 KLSNRLRSVGWEINDIRTCPANSNLIVCASSDQSIRIHHI-RNEACL-IVIGGLECHAGT 196

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFE 346
           I  V  S+DG++ LS  +D  L  WDL+  +     E
Sbjct: 197 ILSVDWSTDGDFILSCGFDHQLMEWDLSVKQVKEHLE 233


>AF039038-8|AAM81097.1|  874|Caenorhabditis elegans Hypothetical
            protein K06A5.8a protein.
          Length = 874

 Score = 34.7 bits (76), Expect = 0.055
 Identities = 22/99 (22%), Positives = 47/99 (47%), Gaps = 1/99 (1%)
 Frame = +2

Query: 50   TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDEN-NYGIPQKRLYGH 226
            T +L  +++GH   +  + T  +  +  +S S+DKT+  W L +    N   P      +
Sbjct: 762  TGQLIQSMKGHTAPILGLYTWSQAGNQFVSCSQDKTIRFWDLRQQTAVNVISPGSNKSHN 821

Query: 227  SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRF 343
            +  ++ V +  +G   +SG  D ++ L+D+   +  + F
Sbjct: 822  ASPVTSVCVDPNGKLLVSGHEDASVALFDIGGNRILQTF 860


>Z83120-6|CAB76722.1|  809|Caenorhabditis elegans Hypothetical
           protein R06A4.9 protein.
          Length = 809

 Score = 34.3 bits (75), Expect = 0.072
 Identities = 26/98 (26%), Positives = 44/98 (44%), Gaps = 2/98 (2%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRD--KTLIVWKLTRDENNYGIPQKRLYGHSHFISD 244
           LRGH   V  I  +P    +I + SRD  + + +W     +   G     L  H   +  
Sbjct: 255 LRGHGAEVRCIDWHPT-KGLIATGSRDTQQPVKIW-----DPKSGSCLATLQEHKSSVMA 308

Query: 245 VVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           V  + +GN+ L+G  D  ++++D+   K  R +  H K
Sbjct: 309 VEFNKNGNWLLTGGRDHLVKMYDIRMMKEMRTYRAHKK 346



 Score = 29.5 bits (63), Expect = 2.1
 Identities = 19/86 (22%), Positives = 36/86 (41%)
 Frame = +2

Query: 53  LKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSH 232
           +K   T R H   V  +A +P +  + +S   D +++ W +   E   G+ +   + H  
Sbjct: 335 MKEMRTYRAHKKEVISLAWHPIHEGLFVSGGGDGSIVYW-MVDGEKEIGLLE---HAHDQ 390

Query: 233 FISDVVLSSDGNYALSGSWDKTLRLW 310
            I  +     G+   +GS D   + W
Sbjct: 391 AIWSMKWHPLGHILATGSNDNNTKFW 416


>Z48809-2|CAA88747.1|  406|Caenorhabditis elegans Hypothetical
           protein T01E8.4 protein.
          Length = 406

 Score = 33.5 bits (73), Expect = 0.13
 Identities = 15/34 (44%), Positives = 22/34 (64%), Gaps = 2/34 (5%)
 Frame = +2

Query: 221 GHSHFISDVVLSSDGN--YALSGSWDKTLRLWDL 316
           GHS  +  V+L  + N  + LSGS D+T+RLW +
Sbjct: 101 GHSATVDSVMLFENNNKQFCLSGSRDRTIRLWSI 134



 Score = 33.1 bits (72), Expect = 0.17
 Identities = 23/90 (25%), Positives = 36/90 (40%), Gaps = 7/90 (7%)
 Frame = +2

Query: 68  TLRGHNGWVTQIAT-NPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQ------KRLYGH 226
           T  GH+  V  +           LS SRD+T+ +W +    N     Q      K    H
Sbjct: 98  TAPGHSATVDSVMLFENNNKQFCLSGSRDRTIRLWSIENARNGEDTEQNPWTVAKDDTAH 157

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           S +I ++   S      + SWD T++ W +
Sbjct: 158 SGWIWNMAQESTSTNFYTTSWDSTVKSWHI 187


>U89245-1|AAB49459.1|  612|Caenorhabditis elegans transcription
           factor UNC-37 protein.
          Length = 612

 Score = 33.5 bits (73), Expect = 0.13
 Identities = 18/49 (36%), Positives = 25/49 (51%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
           L GH    S + LS DG    SG  D ++R WDLA  K   + +  ++V
Sbjct: 454 LPGHQDGASCLDLSKDGTKLWSGGLDNSVRCWDLAQRKEVAKHDFASQV 502


>AF003141-10|AAK21487.1|  612|Caenorhabditis elegans Uncoordinated
           protein 37 protein.
          Length = 612

 Score = 33.5 bits (73), Expect = 0.13
 Identities = 18/49 (36%), Positives = 25/49 (51%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
           L GH    S + LS DG    SG  D ++R WDLA  K   + +  ++V
Sbjct: 454 LPGHQDGASCLDLSKDGTKLWSGGLDNSVRCWDLAQRKEVAKHDFASQV 502


>AF001272-1|AAB84235.1|  612|Caenorhabditis elegans enhancer of
           split groucho protein.
          Length = 612

 Score = 33.5 bits (73), Expect = 0.13
 Identities = 18/49 (36%), Positives = 25/49 (51%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
           L GH    S + LS DG    SG  D ++R WDLA  K   + +  ++V
Sbjct: 454 LPGHQDGASCLDLSKDGTKLWSGGLDNSVRCWDLAQRKEVAKHDFASQV 502


>AF001271-1|AAB84234.1|  612|Caenorhabditis elegans enhancer of
           split groucho protein.
          Length = 612

 Score = 33.5 bits (73), Expect = 0.13
 Identities = 18/49 (36%), Positives = 25/49 (51%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
           L GH    S + LS DG    SG  D ++R WDLA  K   + +  ++V
Sbjct: 454 LPGHQDGASCLDLSKDGTKLWSGGLDNSVRCWDLAQRKEVAKHDFASQV 502


>AC006684-12|AAN60497.1|  528|Caenorhabditis elegans Hypothetical
           protein T02H6.1b protein.
          Length = 528

 Score = 33.1 bits (72), Expect = 0.17
 Identities = 21/80 (26%), Positives = 39/80 (48%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH G +  +    K  + + S+S+D+++ +W    D +  G+    +YGH   +  + 
Sbjct: 244 LSGHRGPIFSLTFQLK-TNNLYSASQDRSVKMW----DIDQLGLVDT-MYGHQDGVQQIG 297

Query: 251 LSSDGNYALSGSWDKTLRLW 310
           + S    A  G  D++ RLW
Sbjct: 298 VLSKQRVATVGGRDRSARLW 317



 Score = 33.1 bits (72), Expect = 0.17
 Identities = 20/74 (27%), Positives = 35/74 (47%)
 Frame = +2

Query: 65  GTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISD 244
           GT  G   W+  +A  P Y D++ S S +  L +WK++  EN   +     Y    FI+ 
Sbjct: 375 GTQNGSGRWIVALAVLP-YSDLLASGSNEGELKLWKIS--ENFRQLTPFFSYSIPGFINS 431

Query: 245 VVLSSDGNYALSGS 286
           +  + +G   + G+
Sbjct: 432 INFAPNGKSIVVGA 445


>AC006684-11|AAF39968.1|  550|Caenorhabditis elegans Hypothetical
           protein T02H6.1a protein.
          Length = 550

 Score = 33.1 bits (72), Expect = 0.17
 Identities = 21/80 (26%), Positives = 39/80 (48%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH G +  +    K  + + S+S+D+++ +W    D +  G+    +YGH   +  + 
Sbjct: 244 LSGHRGPIFSLTFQLK-TNNLYSASQDRSVKMW----DIDQLGLVDT-MYGHQDGVQQIG 297

Query: 251 LSSDGNYALSGSWDKTLRLW 310
           + S    A  G  D++ RLW
Sbjct: 298 VLSKQRVATVGGRDRSARLW 317



 Score = 33.1 bits (72), Expect = 0.17
 Identities = 20/74 (27%), Positives = 35/74 (47%)
 Frame = +2

Query: 65  GTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISD 244
           GT  G   W+  +A  P Y D++ S S +  L +WK++  EN   +     Y    FI+ 
Sbjct: 375 GTQNGSGRWIVALAVLP-YSDLLASGSNEGELKLWKIS--ENFRQLTPFFSYSIPGFINS 431

Query: 245 VVLSSDGNYALSGS 286
           +  + +G   + G+
Sbjct: 432 INFAPNGKSIVVGA 445


>Z83016-1|CAB05407.1|  451|Caenorhabditis elegans Hypothetical
           protein F46C5.9 protein.
          Length = 451

 Score = 32.7 bits (71), Expect = 0.22
 Identities = 14/34 (41%), Positives = 22/34 (64%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           L GH   ++DV  +SDG   +S S D+++ LWD+
Sbjct: 87  LKGHKKEVTDVAFASDGKKFVSISGDRSVILWDV 120


>Z68314-8|CAA92666.1|  451|Caenorhabditis elegans Hypothetical
           protein F46C5.9 protein.
          Length = 451

 Score = 32.7 bits (71), Expect = 0.22
 Identities = 14/34 (41%), Positives = 22/34 (64%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           L GH   ++DV  +SDG   +S S D+++ LWD+
Sbjct: 87  LKGHKKEVTDVAFASDGKKFVSISGDRSVILWDV 120


>Z54281-9|CAA91052.1|  451|Caenorhabditis elegans Hypothetical
           protein F46C5.9 protein.
          Length = 451

 Score = 32.7 bits (71), Expect = 0.22
 Identities = 14/34 (41%), Positives = 22/34 (64%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           L GH   ++DV  +SDG   +S S D+++ LWD+
Sbjct: 87  LKGHKKEVTDVAFASDGKKFVSISGDRSVILWDV 120


>Z83122-11|CAB05603.2|  648|Caenorhabditis elegans Hypothetical
           protein F30F8.8 protein.
          Length = 648

 Score = 32.3 bits (70), Expect = 0.29
 Identities = 27/106 (25%), Positives = 42/106 (39%)
 Frame = +2

Query: 32  FSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQK 211
           F     T  +R T  GH G V  +  +P    +++SS+ D+T+ +W +    N       
Sbjct: 379 FDLQGSTTSVRYT--GHGGPVFSVNFSPDRR-LLISSAGDRTVRLWSMETQRNAV----- 430

Query: 212 RLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFED 349
            +Y     +      S G Y  + S DKT  +W        R F D
Sbjct: 431 -IYRTPAVVWQAQFCSRGYYFATASADKTAAMWSTDRMHPLRIFAD 475



 Score = 32.3 bits (70), Expect = 0.29
 Identities = 22/89 (24%), Positives = 38/89 (42%), Gaps = 1/89 (1%)
 Frame = +2

Query: 89  WVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF-ISDVVLSSDG 265
           W  Q  +   Y     ++S DKT  +W   R      +   R++   +  +  +    + 
Sbjct: 439 WQAQFCSRGYY---FATASADKTAAMWSTDR------MHPLRIFADPYGDVGCIDYHPNC 489

Query: 266 NYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           NY   GS D+ +R+WD+ +G   R F  H
Sbjct: 490 NYIAGGSDDRYVRVWDVCSGTRVRIFSGH 518


>Z81523-5|CAB04240.2|  298|Caenorhabditis elegans Hypothetical
           protein F32H2.4 protein.
          Length = 298

 Score = 32.3 bits (70), Expect = 0.29
 Identities = 12/44 (27%), Positives = 25/44 (56%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQK 211
           H+  V Q+A + K P++  S+S D+ + VW + + +  + I  +
Sbjct: 46  HSSSVEQVACSEKQPNLFASASADRNICVWDIRQSKPTHRISNR 89


>Z81073-10|CAB03035.2|  648|Caenorhabditis elegans Hypothetical
           protein F30F8.8 protein.
          Length = 648

 Score = 32.3 bits (70), Expect = 0.29
 Identities = 27/106 (25%), Positives = 42/106 (39%)
 Frame = +2

Query: 32  FSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQK 211
           F     T  +R T  GH G V  +  +P    +++SS+ D+T+ +W +    N       
Sbjct: 379 FDLQGSTTSVRYT--GHGGPVFSVNFSPDRR-LLISSAGDRTVRLWSMETQRNAV----- 430

Query: 212 RLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFED 349
            +Y     +      S G Y  + S DKT  +W        R F D
Sbjct: 431 -IYRTPAVVWQAQFCSRGYYFATASADKTAAMWSTDRMHPLRIFAD 475



 Score = 32.3 bits (70), Expect = 0.29
 Identities = 22/89 (24%), Positives = 38/89 (42%), Gaps = 1/89 (1%)
 Frame = +2

Query: 89  WVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF-ISDVVLSSDG 265
           W  Q  +   Y     ++S DKT  +W   R      +   R++   +  +  +    + 
Sbjct: 439 WQAQFCSRGYY---FATASADKTAAMWSTDR------MHPLRIFADPYGDVGCIDYHPNC 489

Query: 266 NYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           NY   GS D+ +R+WD+ +G   R F  H
Sbjct: 490 NYIAGGSDDRYVRVWDVCSGTRVRIFSGH 518


>U41007-1|AAA82264.1|  326|Caenorhabditis elegans Hypothetical
           protein C33H5.7 protein.
          Length = 326

 Score = 32.3 bits (70), Expect = 0.29
 Identities = 24/81 (29%), Positives = 39/81 (48%), Gaps = 2/81 (2%)
 Frame = +2

Query: 125 DMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSW--DKT 298
           D ++ S+ D ++ ++ +     +  +  K+ YG SH    V  +SD   AL GS   D T
Sbjct: 39  DHMIMSTDDDSMFLYDMNTGLRSRSVNSKK-YGCSH----VKFASDSMCALHGSTKVDNT 93

Query: 299 LRLWDLAAGKTTRRFEDHTKV 361
           +R   L   K  R F+ H K+
Sbjct: 94  IRYLSLTDNKYIRYFQGHDKL 114



 Score = 30.7 bits (66), Expect = 0.89
 Identities = 20/60 (33%), Positives = 31/60 (51%)
 Frame = +2

Query: 137 SSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           S+  D T+    LT  +N Y    +   GH   ++ + +S   +  LS + DKT+RLWDL
Sbjct: 87  STKVDNTIRYLSLT--DNKY---IRYFQGHDKLVTGINVSPMDDMFLSVAEDKTIRLWDL 141



 Score = 29.9 bits (64), Expect = 1.6
 Identities = 15/34 (44%), Positives = 21/34 (61%)
 Frame = +2

Query: 74  RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKL 175
           +GH+  VT I  +P   DM LS + DKT+ +W L
Sbjct: 109 QGHDKLVTGINVSPM-DDMFLSVAEDKTIRLWDL 141


>AC024214-18|AAF36083.1|  211|Caenorhabditis elegans Nuclear pore
           complex protein protein20, isoform b protein.
          Length = 211

 Score = 32.3 bits (70), Expect = 0.29
 Identities = 14/34 (41%), Positives = 24/34 (70%), Gaps = 1/34 (2%)
 Frame = +2

Query: 71  LRGHNGWVTQIA-TNPKYPDMILSSSRDKTLIVW 169
           L GH+G V +++  +PKY  ++ S+S DK +I+W
Sbjct: 54  LVGHSGPVWKVSWAHPKYGGLLASASYDKKVIIW 87


>AC024214-17|AAF36082.1|  313|Caenorhabditis elegans Nuclear pore
           complex protein protein20, isoform a protein.
          Length = 313

 Score = 32.3 bits (70), Expect = 0.29
 Identities = 14/34 (41%), Positives = 24/34 (70%), Gaps = 1/34 (2%)
 Frame = +2

Query: 71  LRGHNGWVTQIA-TNPKYPDMILSSSRDKTLIVW 169
           L GH+G V +++  +PKY  ++ S+S DK +I+W
Sbjct: 54  LVGHSGPVWKVSWAHPKYGGLLASASYDKKVIIW 87


>Z31590-4|CAD27606.1|  495|Caenorhabditis elegans Hypothetical
           protein R01H10.3d protein.
          Length = 495

 Score = 31.9 bits (69), Expect = 0.39
 Identities = 22/97 (22%), Positives = 41/97 (42%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH   V  IA +P   +++L++  +  + +W +       G     + GH   I  + 
Sbjct: 125 LTGHQKRVNTIAWHPVANNVLLTAGGENVMFMWNV-----GTGEALLEISGHPDQIWSIN 179

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
            + DG+  ++   DK +R+ D   G+       H  V
Sbjct: 180 FNFDGSQFVTTCKDKKIRILDSHTGEVVHEGMGHEGV 216


>Z31590-3|CAD27605.1|  607|Caenorhabditis elegans Hypothetical
           protein R01H10.3c protein.
          Length = 607

 Score = 31.9 bits (69), Expect = 0.39
 Identities = 22/97 (22%), Positives = 41/97 (42%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH   V  IA +P   +++L++  +  + +W +       G     + GH   I  + 
Sbjct: 125 LTGHQKRVNTIAWHPVANNVLLTAGGENVMFMWNV-----GTGEALLEISGHPDQIWSIN 179

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
            + DG+  ++   DK +R+ D   G+       H  V
Sbjct: 180 FNFDGSQFVTTCKDKKIRILDSHTGEVVHEGMGHEGV 216


>Z31590-2|CAD27604.1|  538|Caenorhabditis elegans Hypothetical
           protein R01H10.3b protein.
          Length = 538

 Score = 31.9 bits (69), Expect = 0.39
 Identities = 22/97 (22%), Positives = 41/97 (42%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH   V  IA +P   +++L++  +  + +W +       G     + GH   I  + 
Sbjct: 125 LTGHQKRVNTIAWHPVANNVLLTAGGENVMFMWNV-----GTGEALLEISGHPDQIWSIN 179

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
            + DG+  ++   DK +R+ D   G+       H  V
Sbjct: 180 FNFDGSQFVTTCKDKKIRILDSHTGEVVHEGMGHEGV 216


>Z31590-1|CAA83461.1|  605|Caenorhabditis elegans Hypothetical
           protein R01H10.3a protein.
          Length = 605

 Score = 31.9 bits (69), Expect = 0.39
 Identities = 22/97 (22%), Positives = 41/97 (42%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH   V  IA +P   +++L++  +  + +W +       G     + GH   I  + 
Sbjct: 125 LTGHQKRVNTIAWHPVANNVLLTAGGENVMFMWNV-----GTGEALLEISGHPDQIWSIN 179

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
            + DG+  ++   DK +R+ D   G+       H  V
Sbjct: 180 FNFDGSQFVTTCKDKKIRILDSHTGEVVHEGMGHEGV 216


>U23449-4|AAC24299.2|  534|Caenorhabditis elegans Hypothetical
           protein K06A1.5 protein.
          Length = 534

 Score = 31.9 bits (69), Expect = 0.39
 Identities = 20/63 (31%), Positives = 32/63 (50%)
 Frame = +2

Query: 134 LSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWD 313
           L+SS DKT  +W +  D            GH+  +S   L    N  +SGS D+T++ WD
Sbjct: 306 LASSNDKTCRLWNI--DSQRL---LSTFSGHTDKVSSARLFQSHN-VISGSADRTIKNWD 359

Query: 314 LAA 322
           +++
Sbjct: 360 ISS 362



 Score = 31.5 bits (68), Expect = 0.51
 Identities = 23/69 (33%), Positives = 34/69 (49%), Gaps = 3/69 (4%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQ---KRLYGHSHFISDVVLSSDGNYALSGSWDKTL 301
           +L+SSRD TL +     D  NYGI        Y  S   +  + SS G Y L+GS + ++
Sbjct: 430 VLASSRDDTLSLI----DVRNYGIIHLYSAEQYKTSCDSTRAIFSSTGEYVLAGSSNSSV 485

Query: 302 RLWDLAAGK 328
            +W+    K
Sbjct: 486 FIWNTKTTK 494



 Score = 29.9 bits (64), Expect = 1.6
 Identities = 17/77 (22%), Positives = 36/77 (46%)
 Frame = +2

Query: 125 DMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLR 304
           D   ++  D  + +W+++ ++ +       L G    ++ +   S  +  L+ S DKT R
Sbjct: 257 DTFATAGSDSKVQIWRVSPNKTDAS-KVSTLSGCLGPVNRLDYDSQRHVCLASSNDKTCR 315

Query: 305 LWDLAAGKTTRRFEDHT 355
           LW++ + +    F  HT
Sbjct: 316 LWNIDSQRLLSTFSGHT 332


>Z81099-1|CAB03187.1|  600|Caenorhabditis elegans Hypothetical
           protein K08F9.2 protein.
          Length = 600

 Score = 31.5 bits (68), Expect = 0.51
 Identities = 15/53 (28%), Positives = 29/53 (54%)
 Frame = +2

Query: 197 GIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           G  +K   GH+  I+ +  SSDG +  S   +  +  W++++G ++R+   HT
Sbjct: 312 GSVEKIRQGHNKAITALSKSSDGKFLFSADAEGHITTWEISSGTSSRK-SPHT 363



 Score = 30.7 bits (66), Expect = 0.89
 Identities = 22/102 (21%), Positives = 44/102 (43%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           K + T   H  +V     N     +  S+  D T++++     E    +   +   H+  
Sbjct: 181 KFKHTFDHHKKFVQSTRYNND-GSLFASTGSDGTVVLYNGVDGEKVGVLEDAKGVAHTGS 239

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
           I  +  S D +   + S DK++++WD++A K  R     +K+
Sbjct: 240 IFALAWSPDQSRIATASADKSVKIWDVSARKLERTIVMGSKI 281


>Z80216-3|CAB02280.1|  373|Caenorhabditis elegans Hypothetical
           protein F10G8.3 protein.
          Length = 373

 Score = 31.5 bits (68), Expect = 0.51
 Identities = 23/80 (28%), Positives = 36/80 (45%), Gaps = 1/80 (1%)
 Frame = +2

Query: 92  VTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNY-GIPQKRLYGHSHFISDVVLSSDGN 268
           V + +  P+   M+   S D T+ VW +  D N + G  Q+ +      I D+    D +
Sbjct: 47  VIKFSPTPQDKPMLACGSWDGTIRVW-MFNDANTFEGKAQQNIPAP---ILDIAWIEDSS 102

Query: 269 YALSGSWDKTLRLWDLAAGK 328
                  DK  RLWDLA+ +
Sbjct: 103 KIFIACADKEARLWDLASNQ 122



 Score = 27.5 bits (58), Expect = 8.3
 Identities = 9/14 (64%), Positives = 13/14 (92%)
 Frame = +2

Query: 275 LSGSWDKTLRLWDL 316
           ++GS+DKTLR WD+
Sbjct: 148 MTGSFDKTLRFWDM 161


>U41007-2|AAA82265.1|  248|Caenorhabditis elegans Hypothetical
           protein C33H5.6 protein.
          Length = 248

 Score = 31.5 bits (68), Expect = 0.51
 Identities = 27/80 (33%), Positives = 38/80 (47%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH   V  I TNPK  +  LSSS D  + ++  TR   NYG     L GH+  I+     
Sbjct: 109 GHRMPVNFIRTNPKDREKFLSSSVDGEIRMFD-TRTFENYGC---LLAGHTPLIA---FD 161

Query: 257 SDGNYALSGSWDKTLRLWDL 316
            DG      +   T++L+D+
Sbjct: 162 PDGILFAVATKSDTIKLFDM 181


>U21321-1|AAG00051.1|  507|Caenorhabditis elegans Fizzy (cdc20
           protein family) homologprotein 1 protein.
          Length = 507

 Score = 31.5 bits (68), Expect = 0.51
 Identities = 12/31 (38%), Positives = 20/31 (64%)
 Frame = +2

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWD 313
           GH   ++ +  S+D N  +SGS D+T ++WD
Sbjct: 313 GHCRDVTALEWSADENMCVSGSSDRTAKIWD 343


>AL110490-1|CAB54439.1|  674|Caenorhabditis elegans Hypothetical
           protein Y48B6A.1 protein.
          Length = 674

 Score = 30.7 bits (66), Expect = 0.89
 Identities = 11/35 (31%), Positives = 19/35 (54%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKL 175
           +RGH G V  I   P+  +++ S   D T+ +W +
Sbjct: 340 MRGHTGQVRAITVEPERGELLASGGEDGTVRIWMI 374


>Z93390-7|CAB07677.1|  931|Caenorhabditis elegans Hypothetical
           protein VT23B5.2 protein.
          Length = 931

 Score = 30.3 bits (65), Expect = 1.2
 Identities = 18/58 (31%), Positives = 34/58 (58%)
 Frame = +2

Query: 5   SGXSSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLT 178
           SG  +++K  +K     KL   L GH+  +T + +   +  +++S+SRD T++VW L+
Sbjct: 560 SGCITVWKVNNKPLSMKKL-SVLNGHSDAITCLVSCQSHA-VLVSASRDLTVLVWHLS 615


>AL132904-13|CAC35846.4|  778|Caenorhabditis elegans Hypothetical
           protein Y111B2A.17 protein.
          Length = 778

 Score = 30.3 bits (65), Expect = 1.2
 Identities = 12/32 (37%), Positives = 18/32 (56%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           + GH  ++   V S+DG   L+ S DKT  +W
Sbjct: 283 MQGHDDWVHSTVWSNDGRVLLTASSDKTCIIW 314



 Score = 29.9 bits (64), Expect = 1.6
 Identities = 17/48 (35%), Positives = 27/48 (56%), Gaps = 4/48 (8%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWK----LTRDENNYGI 202
           ++GH+ WV     +     ++L++S DKT I+WK    L RD+   GI
Sbjct: 283 MQGHDDWVHSTVWSND-GRVLLTASSDKTCIIWKEIDNLWRDDVRLGI 329


>AL032675-2|CAA21780.1|  931|Caenorhabditis elegans Hypothetical
           protein VT23B5.2 protein.
          Length = 931

 Score = 30.3 bits (65), Expect = 1.2
 Identities = 18/58 (31%), Positives = 34/58 (58%)
 Frame = +2

Query: 5   SGXSSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLT 178
           SG  +++K  +K     KL   L GH+  +T + +   +  +++S+SRD T++VW L+
Sbjct: 560 SGCITVWKVNNKPLSMKKL-SVLNGHSDAITCLVSCQSHA-VLVSASRDLTVLVWHLS 615


>U41035-2|AAM69088.1| 1371|Caenorhabditis elegans Uncoordinated
            protein 10, isoform b protein.
          Length = 1371

 Score = 29.9 bits (64), Expect = 1.6
 Identities = 11/34 (32%), Positives = 19/34 (55%)
 Frame = +2

Query: 179  RDENNYGIPQKRLYGHSHFISDVVLSSDGNYALS 280
            RD+N Y + +   +G  +++ D  L  DG Y +S
Sbjct: 1126 RDDNEYSMRESVRHGSQYYLGDQPLYEDGRYKIS 1159


>U41035-1|AAB37028.2| 1563|Caenorhabditis elegans Uncoordinated
            protein 10, isoform a protein.
          Length = 1563

 Score = 29.9 bits (64), Expect = 1.6
 Identities = 11/34 (32%), Positives = 19/34 (55%)
 Frame = +2

Query: 179  RDENNYGIPQKRLYGHSHFISDVVLSSDGNYALS 280
            RD+N Y + +   +G  +++ D  L  DG Y +S
Sbjct: 1142 RDDNEYSMRESVRHGSQYYLGDQPLYEDGRYKIS 1175


>AF257062-1|AAK49331.1| 1563|Caenorhabditis elegans Rab3-interacting
            molecule UNC-10 protein.
          Length = 1563

 Score = 29.9 bits (64), Expect = 1.6
 Identities = 11/34 (32%), Positives = 19/34 (55%)
 Frame = +2

Query: 179  RDENNYGIPQKRLYGHSHFISDVVLSSDGNYALS 280
            RD+N Y + +   +G  +++ D  L  DG Y +S
Sbjct: 1142 RDDNEYSMRESVRHGSQYYLGDQPLYEDGRYKIS 1175


>AC024791-30|AAL32250.2| 2460|Caenorhabditis elegans Hypothetical
           protein Y47G6A.29 protein.
          Length = 2460

 Score = 29.9 bits (64), Expect = 1.6
 Identities = 11/22 (50%), Positives = 13/22 (59%)
 Frame = -2

Query: 452 KHWSSASHRHLGLSSVHNQHLH 387
           K+W S  HRHL LS+     LH
Sbjct: 107 KYWKSVEHRHLNLSTKRASRLH 128


>AL034393-7|CAA22322.2|  337|Caenorhabditis elegans Hypothetical
           protein Y18D10A.9 protein.
          Length = 337

 Score = 29.5 bits (63), Expect = 2.1
 Identities = 20/80 (25%), Positives = 38/80 (47%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH   V + A   K  + + + SRDK++  W+   DE ++ +    L  H+  +  V 
Sbjct: 107 LEGHESEV-KCAVFSKSDEFLATCSRDKSVWFWQQDEDE-DFSV-SSILQPHTQDVKQVA 163

Query: 251 LSSDGNYALSGSWDKTLRLW 310
                +  +S S+D ++R +
Sbjct: 164 WHPTEDLLVSCSYDSSIRFY 183


>AL110478-6|CAE17957.2|  952|Caenorhabditis elegans Hypothetical
           protein Y26D4A.14 protein.
          Length = 952

 Score = 28.7 bits (61), Expect = 3.6
 Identities = 12/34 (35%), Positives = 18/34 (52%)
 Frame = -2

Query: 548 YDGRYIYNTIIILPSYLRLLQHKHNLLPRKGTKH 447
           YD  YI++T +  P Y  L+    N L +K  +H
Sbjct: 764 YDNLYIFSTTLFQPCYQALINGFENGLSKKDIRH 797


>Z92813-8|CAB07290.1| 1057|Caenorhabditis elegans Hypothetical
           protein Y76A2B.1 protein.
          Length = 1057

 Score = 28.3 bits (60), Expect = 4.8
 Identities = 28/94 (29%), Positives = 45/94 (47%), Gaps = 6/94 (6%)
 Frame = +2

Query: 92  VTQIATNPKYPDMILSSSRDKTLIVWKLTRDEN--NYGIPQKRLYGHSHFISDV---VLS 256
           VT +  NP   + +   +    + +W+LT ++   N   P+K +      I+ +    L+
Sbjct: 631 VTDLHWNPFDDEQLAVGTDCGQINLWRLTTNDGPRNEMEPEKIIKIGGEKITSLRWHPLA 690

Query: 257 SDG-NYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           SD    ALS S   T+ LWD+A  K   RF +HT
Sbjct: 691 SDLLAVALSNS---TIELWDVANAKLYSRFVNHT 721



 Score = 27.5 bits (58), Expect = 8.3
 Identities = 22/91 (24%), Positives = 43/91 (47%), Gaps = 2/91 (2%)
 Frame = +2

Query: 65  GTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISD 244
           G +  H   V          +++ + SRD+ + +WKL+RD ++  +  +   G  + I++
Sbjct: 74  GIIAAHGEQVADFGFLTFADELLATCSRDEPVKIWKLSRD-HSPKLATEIDVGGGNVIAE 132

Query: 245 VVL--SSDGNYALSGSWDKTLRLWDLAAGKT 331
            +   S+  N    GS   T  + D++ GKT
Sbjct: 133 CLRAHSTADNILAVGSHGSTY-ITDISTGKT 162


>Z82266-11|CAB05177.4| 1192|Caenorhabditis elegans Hypothetical
           protein F23B2.4 protein.
          Length = 1192

 Score = 28.3 bits (60), Expect = 4.8
 Identities = 20/59 (33%), Positives = 25/59 (42%)
 Frame = +2

Query: 191 NYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV*Q 367
           N G   + L GH   +  V  S +G    SG  DK + LW+     T R    HT V Q
Sbjct: 48  NEGGQMQTLKGHKDLVYTVAWSHNGELFASGGADKLVILWNEKHEGTLR--YSHTDVIQ 104


>Z70213-1|CAA94175.1| 1354|Caenorhabditis elegans Hypothetical protein
            ZK930.1 protein.
          Length = 1354

 Score = 28.3 bits (60), Expect = 4.8
 Identities = 19/60 (31%), Positives = 30/60 (50%), Gaps = 4/60 (6%)
 Frame = +2

Query: 182  DENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWD----LAAGKTTRRFED 349
            + N  GI    L+ HS  I+ +  + + +  LSGS D T+++W     L  G  + R ED
Sbjct: 953  NNNVKGIIITHLHEHSGKITKLCANRESDLFLSGSTDGTVKVWKTRSVLGEGYGSARSED 1012


>Z68315-3|CAA92670.1|  430|Caenorhabditis elegans Hypothetical
           protein F28C6.3 protein.
          Length = 430

 Score = 28.3 bits (60), Expect = 4.8
 Identities = 12/37 (32%), Positives = 22/37 (59%)
 Frame = +2

Query: 209 KRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLA 319
           + LY H   ++ V+     +  +SGS DKT++L+D +
Sbjct: 164 RTLYDHVDDVNTVIFHPRDSILISGSNDKTVKLFDFS 200


>Z46676-3|CAA86663.1| 1244|Caenorhabditis elegans Hypothetical protein
            C08B11.3 protein.
          Length = 1244

 Score = 28.3 bits (60), Expect = 4.8
 Identities = 15/46 (32%), Positives = 25/46 (54%)
 Frame = -1

Query: 372  EFCHTLVWSSNRLVVLPAARSHKRKVLSQEPERA*LPSLDSTTSEM 235
            E  H L    + L   PAA   ++K+LS+ P  A L S+  ++S++
Sbjct: 1115 ESAHALSQLLSELHQAPAAEEEQQKMLSEVPSSASLSSMAGSSSQL 1160


>DQ360810-1|ABC88647.1| 1192|Caenorhabditis elegans intraflagellar
           transport protein protein.
          Length = 1192

 Score = 28.3 bits (60), Expect = 4.8
 Identities = 20/59 (33%), Positives = 25/59 (42%)
 Frame = +2

Query: 191 NYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV*Q 367
           N G   + L GH   +  V  S +G    SG  DK + LW+     T R    HT V Q
Sbjct: 48  NEGGQMQTLKGHKDLVYTVAWSHNGELFASGGADKLVILWNEKHEGTLR--YSHTDVIQ 104


>AL032658-5|CAA21748.1| 1057|Caenorhabditis elegans Hypothetical
           protein Y76A2B.1 protein.
          Length = 1057

 Score = 28.3 bits (60), Expect = 4.8
 Identities = 28/94 (29%), Positives = 45/94 (47%), Gaps = 6/94 (6%)
 Frame = +2

Query: 92  VTQIATNPKYPDMILSSSRDKTLIVWKLTRDEN--NYGIPQKRLYGHSHFISDV---VLS 256
           VT +  NP   + +   +    + +W+LT ++   N   P+K +      I+ +    L+
Sbjct: 631 VTDLHWNPFDDEQLAVGTDCGQINLWRLTTNDGPRNEMEPEKIIKIGGEKITSLRWHPLA 690

Query: 257 SDG-NYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           SD    ALS S   T+ LWD+A  K   RF +HT
Sbjct: 691 SDLLAVALSNS---TIELWDVANAKLYSRFVNHT 721



 Score = 27.5 bits (58), Expect = 8.3
 Identities = 22/91 (24%), Positives = 43/91 (47%), Gaps = 2/91 (2%)
 Frame = +2

Query: 65  GTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISD 244
           G +  H   V          +++ + SRD+ + +WKL+RD ++  +  +   G  + I++
Sbjct: 74  GIIAAHGEQVADFGFLTFADELLATCSRDEPVKIWKLSRD-HSPKLATEIDVGGGNVIAE 132

Query: 245 VVL--SSDGNYALSGSWDKTLRLWDLAAGKT 331
            +   S+  N    GS   T  + D++ GKT
Sbjct: 133 CLRAHSTADNILAVGSHGSTY-ITDISTGKT 162


>AF129126-1|AAD25089.2| 1057|Caenorhabditis elegans POD-1 protein.
          Length = 1057

 Score = 28.3 bits (60), Expect = 4.8
 Identities = 28/94 (29%), Positives = 45/94 (47%), Gaps = 6/94 (6%)
 Frame = +2

Query: 92  VTQIATNPKYPDMILSSSRDKTLIVWKLTRDEN--NYGIPQKRLYGHSHFISDV---VLS 256
           VT +  NP   + +   +    + +W+LT ++   N   P+K +      I+ +    L+
Sbjct: 631 VTDLHWNPFDDEQLAVGTDCGQINLWRLTTNDGPRNEMEPEKIIKIGGEKITSLRWHPLA 690

Query: 257 SDG-NYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           SD    ALS S   T+ LWD+A  K   RF +HT
Sbjct: 691 SDLLAVALSNS---TIELWDVANAKLYSRFVNHT 721



 Score = 27.5 bits (58), Expect = 8.3
 Identities = 22/91 (24%), Positives = 43/91 (47%), Gaps = 2/91 (2%)
 Frame = +2

Query: 65  GTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISD 244
           G +  H   V          +++ + SRD+ + +WKL+RD ++  +  +   G  + I++
Sbjct: 74  GIIAAHGEQVADFGFLTFADELLATCSRDEPVKIWKLSRD-HSPKLATEIDVGGGNVIAE 132

Query: 245 VVL--SSDGNYALSGSWDKTLRLWDLAAGKT 331
            +   S+  N    GS   T  + D++ GKT
Sbjct: 133 CLRAHSTADNILAVGSHGSTY-ITDISTGKT 162


>Z92811-5|CAN86600.1| 1580|Caenorhabditis elegans Hypothetical protein
            T01G1.1c protein.
          Length = 1580

 Score = 27.9 bits (59), Expect = 6.3
 Identities = 16/37 (43%), Positives = 21/37 (56%), Gaps = 2/37 (5%)
 Frame = +2

Query: 248  VLSSDGNYAL--SGSWDKTLRLWDLAAGKTTRRFEDH 352
            VLS D N  L  +GS D+T +LWD+ A +  R    H
Sbjct: 1262 VLSVDVNEKLMVTGSKDRTAKLWDIEACREIRTLGIH 1298


>Z92811-4|CAB07273.2| 1605|Caenorhabditis elegans Hypothetical protein
            T01G1.1a protein.
          Length = 1605

 Score = 27.9 bits (59), Expect = 6.3
 Identities = 16/37 (43%), Positives = 21/37 (56%), Gaps = 2/37 (5%)
 Frame = +2

Query: 248  VLSSDGNYAL--SGSWDKTLRLWDLAAGKTTRRFEDH 352
            VLS D N  L  +GS D+T +LWD+ A +  R    H
Sbjct: 1287 VLSVDVNEKLMVTGSKDRTAKLWDIEACREIRTLGIH 1323


>Z82271-8|CAN86621.1| 1580|Caenorhabditis elegans Hypothetical protein
            T01G1.1c protein.
          Length = 1580

 Score = 27.9 bits (59), Expect = 6.3
 Identities = 16/37 (43%), Positives = 21/37 (56%), Gaps = 2/37 (5%)
 Frame = +2

Query: 248  VLSSDGNYAL--SGSWDKTLRLWDLAAGKTTRRFEDH 352
            VLS D N  L  +GS D+T +LWD+ A +  R    H
Sbjct: 1262 VLSVDVNEKLMVTGSKDRTAKLWDIEACREIRTLGIH 1298


>Z82271-7|CAB05214.2| 1605|Caenorhabditis elegans Hypothetical protein
            T01G1.1a protein.
          Length = 1605

 Score = 27.9 bits (59), Expect = 6.3
 Identities = 16/37 (43%), Positives = 21/37 (56%), Gaps = 2/37 (5%)
 Frame = +2

Query: 248  VLSSDGNYAL--SGSWDKTLRLWDLAAGKTTRRFEDH 352
            VLS D N  L  +GS D+T +LWD+ A +  R    H
Sbjct: 1287 VLSVDVNEKLMVTGSKDRTAKLWDIEACREIRTLGIH 1323


>Z82271-5|CAI46599.1|  378|Caenorhabditis elegans Hypothetical
           protein T01G1.1b protein.
          Length = 378

 Score = 27.9 bits (59), Expect = 6.3
 Identities = 16/37 (43%), Positives = 21/37 (56%), Gaps = 2/37 (5%)
 Frame = +2

Query: 248 VLSSDGNYAL--SGSWDKTLRLWDLAAGKTTRRFEDH 352
           VLS D N  L  +GS D+T +LWD+ A +  R    H
Sbjct: 60  VLSVDVNEKLMVTGSKDRTAKLWDIEACREIRTLGIH 96


>Z81042-1|CAB02795.1| 1657|Caenorhabditis elegans Hypothetical protein
            C27H6.1 protein.
          Length = 1657

 Score = 27.9 bits (59), Expect = 6.3
 Identities = 9/20 (45%), Positives = 15/20 (75%)
 Frame = -2

Query: 428  RHLGLSSVHNQHLHPNKIKS 369
            RH G+ S+H++ L P K+K+
Sbjct: 1431 RHWGVGSIHSKKLRPGKVKN 1450


>Z79756-5|CAB02115.1|  388|Caenorhabditis elegans Hypothetical
           protein F53C11.8 protein.
          Length = 388

 Score = 27.9 bits (59), Expect = 6.3
 Identities = 13/35 (37%), Positives = 17/35 (48%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKL 175
           LR H G V  IA  P  P  I ++  D   ++W L
Sbjct: 308 LRNHTGPVNGIAWAPHSPHHICTAGDDSQALIWDL 342


>AL032630-10|CAA21566.1|  396|Caenorhabditis elegans Hypothetical
           protein Y62H9A.10 protein.
          Length = 396

 Score = 27.9 bits (59), Expect = 6.3
 Identities = 14/39 (35%), Positives = 22/39 (56%), Gaps = 2/39 (5%)
 Frame = -2

Query: 494 LLQHKHNLLPRKGTK--HWSSASHRHLGLSSVHNQHLHP 384
           L++H H +LPRK TK  ++ + SH  +    V  +  HP
Sbjct: 287 LMKHVHKVLPRKLTKLINFDAQSHSAVSKVKVIRESSHP 325


>AF039038-9|AAO12408.1|  559|Caenorhabditis elegans Hypothetical
           protein K06A5.8d protein.
          Length = 559

 Score = 27.9 bits (59), Expect = 6.3
 Identities = 12/21 (57%), Positives = 14/21 (66%)
 Frame = +2

Query: 254 SSDGNYALSGSWDKTLRLWDL 316
           S  GN  +S S DKT+R WDL
Sbjct: 517 SQAGNQFVSCSQDKTIRFWDL 537


>AB035591-1|BAB18763.1| 1609|Caenorhabditis elegans kinesin like
            protein KLP-12 protein.
          Length = 1609

 Score = 27.9 bits (59), Expect = 6.3
 Identities = 16/37 (43%), Positives = 21/37 (56%), Gaps = 2/37 (5%)
 Frame = +2

Query: 248  VLSSDGNYAL--SGSWDKTLRLWDLAAGKTTRRFEDH 352
            VLS D N  L  +GS D+T +LWD+ A +  R    H
Sbjct: 1291 VLSVDVNEKLMVTGSKDRTAKLWDIEACREIRTLGIH 1327


>Z75525-2|CAA99763.1| 1390|Caenorhabditis elegans Hypothetical
           protein C03D6.4 protein.
          Length = 1390

 Score = 27.5 bits (58), Expect = 8.3
 Identities = 17/54 (31%), Positives = 30/54 (55%)
 Frame = +2

Query: 14  SSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKL 175
           SS  +PF  +  T    GT + + G  + +  NP +PD   +SS D++++V K+
Sbjct: 136 SSSIEPFKPLCTTRV--GTEQINQG--SCLEWNPAFPDTFAASSTDRSILVAKI 185


>Z70684-1|CAA94597.1|  580|Caenorhabditis elegans Hypothetical
           protein F28D1.1 protein.
          Length = 580

 Score = 27.5 bits (58), Expect = 8.3
 Identities = 9/38 (23%), Positives = 18/38 (47%)
 Frame = +2

Query: 203 PQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           P  ++  H   +  + +   GNY  +   D+  R+WD+
Sbjct: 324 PLVKILTHLSAVKGIAVDDQGNYMATTGLDRKCRIWDV 361


>U39850-12|AAZ32806.1| 1336|Caenorhabditis elegans Hypothetical
            protein F52C9.1a protein.
          Length = 1336

 Score = 27.5 bits (58), Expect = 8.3
 Identities = 12/32 (37%), Positives = 18/32 (56%)
 Frame = +2

Query: 221  GHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
            GH   I  +   S+ N  +S S DKT++LW +
Sbjct: 1106 GHQEKIRKLAAISNENSFVSASSDKTVKLWSI 1137


>U39850-11|AAZ32807.1| 1331|Caenorhabditis elegans Hypothetical
            protein F52C9.1b protein.
          Length = 1331

 Score = 27.5 bits (58), Expect = 8.3
 Identities = 12/32 (37%), Positives = 18/32 (56%)
 Frame = +2

Query: 221  GHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
            GH   I  +   S+ N  +S S DKT++LW +
Sbjct: 1106 GHQEKIRKLAAISNENSFVSASSDKTVKLWSI 1137


>AC006757-3|AAF60541.2|  916|Caenorhabditis elegans Hypothetical
           protein Y40C7B.1 protein.
          Length = 916

 Score = 27.5 bits (58), Expect = 8.3
 Identities = 11/34 (32%), Positives = 18/34 (52%)
 Frame = -2

Query: 548 YDGRYIYNTIIILPSYLRLLQHKHNLLPRKGTKH 447
           YD  YI++T +  P Y  L+    N L ++  +H
Sbjct: 728 YDNLYIFSTTLFQPCYQALINGFENGLSKRDIRH 761


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,770,958
Number of Sequences: 27780
Number of extensions: 278901
Number of successful extensions: 1063
Number of sequences better than 10.0: 126
Number of HSP's better than 10.0 without gapping: 769
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 991
length of database: 12,740,198
effective HSP length: 78
effective length of database: 10,573,358
effective search space used: 1374536540
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -