SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A08
         (614 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z75533-9|CAA99814.2|  772|Caenorhabditis elegans Hypothetical pr...    28   6.1  
AF067949-1|AAC19236.2| 1446|Caenorhabditis elegans Suppressor of...    28   6.1  

>Z75533-9|CAA99814.2|  772|Caenorhabditis elegans Hypothetical
           protein C54G4.1a protein.
          Length = 772

 Score = 27.9 bits (59), Expect = 6.1
 Identities = 19/59 (32%), Positives = 32/59 (54%), Gaps = 4/59 (6%)
 Frame = -3

Query: 474 RVFDHEIKDIIAELLCTDFEEAALGLSVSPEIQS---ICSL-WDRACPRCTKPLGIPRV 310
           +  D + +D I +LL    E+  LG +   EI++   + S+ WD A  R  KP+ +PR+
Sbjct: 248 KTMDVDARDFIGQLLEKKLEKR-LGYNGVDEIKNHKFMSSIDWDAAVKRTLKPVIVPRI 305


>AF067949-1|AAC19236.2| 1446|Caenorhabditis elegans Suppressor of
           constitutive dauerformation protein 2 protein.
          Length = 1446

 Score = 27.9 bits (59), Expect = 6.1
 Identities = 11/24 (45%), Positives = 14/24 (58%)
 Frame = +3

Query: 531 PXCYCKNREQHDWLYRPQCFPWCP 602
           P CYC  RE+H  L + +C  W P
Sbjct: 153 PDCYCGKREKHCDLSKEKCH-WTP 175


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,361,063
Number of Sequences: 27780
Number of extensions: 271986
Number of successful extensions: 846
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 805
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 846
length of database: 12,740,198
effective HSP length: 78
effective length of database: 10,573,358
effective search space used: 1332243108
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -