SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A04
         (587 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z35601-1|CAA84667.2|  320|Caenorhabditis elegans Hypothetical pr...   126   9e-30
AB036738-1|BAB13470.1|  320|Caenorhabditis elegans neural RNA-bi...   126   9e-30
D10877-1|BAA01645.1|  346|Caenorhabditis elegans hnRNP like prot...    86   2e-17
AF038613-6|ABB51186.1|  347|Caenorhabditis elegans Human hnrnp a...    86   2e-17
AF038613-5|AAB92051.1|  346|Caenorhabditis elegans Human hnrnp a...    86   2e-17
AF098501-6|AAL38960.1|  315|Caenorhabditis elegans Hypothetical ...    82   2e-16
AF098501-5|AAM69104.1|  335|Caenorhabditis elegans Hypothetical ...    82   2e-16
AF098501-4|AAL38959.1|  336|Caenorhabditis elegans Hypothetical ...    82   2e-16
AC084197-11|AAM44397.1|  305|Caenorhabditis elegans Homologous t...    78   5e-15
AC084197-10|AAY43984.1|  308|Caenorhabditis elegans Homologous t...    78   5e-15
AF038613-8|AAL02515.2|  309|Caenorhabditis elegans Human hnrnp a...    71   5e-13
AF038613-7|ABB51185.1|  308|Caenorhabditis elegans Human hnrnp a...    71   5e-13
Z49910-5|CAA90120.1|  411|Caenorhabditis elegans Hypothetical pr...    64   5e-11
AF047662-1|AAC04442.1|  248|Caenorhabditis elegans Suppressor pr...    58   5e-09
U80455-1|AAB37881.1|  584|Caenorhabditis elegans Elav-type rna b...    56   2e-08
U53931-1|AAA98566.1|  584|Caenorhabditis elegans elav-type ribon...    56   2e-08
EF523770-1|ABS18836.1|  513|Caenorhabditis elegans ELAV-type RNA...    56   2e-08
EF523769-1|ABS18835.1|  327|Caenorhabditis elegans ELAV-type RNA...    56   2e-08
EF523768-1|ABS18834.1|  378|Caenorhabditis elegans ELAV-type RNA...    56   2e-08
EF523766-1|ABS18832.1|  584|Caenorhabditis elegans ELAV-type RNA...    56   2e-08
Z77654-1|CAB01127.1|  114|Caenorhabditis elegans Hypothetical pr...    55   4e-08
Z83230-6|CAB05746.1|  336|Caenorhabditis elegans Hypothetical pr...    53   1e-07
U21320-5|AAA62536.2|  332|Caenorhabditis elegans Rnp (rrm rna bi...    53   1e-07
U23450-2|AAK31468.1|  302|Caenorhabditis elegans Hypothetical pr...    49   2e-06
AL117204-22|CAB55151.1|  331|Caenorhabditis elegans Hypothetical...    48   4e-06
Z78536-3|CAB01717.2|  360|Caenorhabditis elegans Hypothetical pr...    47   1e-05
EF523767-1|ABS18833.1|  193|Caenorhabditis elegans ELAV-type RNA...    47   1e-05
Z36752-6|CAA85327.1|  456|Caenorhabditis elegans Hypothetical pr...    46   2e-05
Z83127-4|CAB05631.1|  872|Caenorhabditis elegans Hypothetical pr...    46   3e-05
Z81108-1|CAB03236.1|   83|Caenorhabditis elegans Hypothetical pr...    46   3e-05
Z50110-2|CAA90446.1|  566|Caenorhabditis elegans Hypothetical pr...    46   3e-05
Z50110-1|CAA90444.1|  692|Caenorhabditis elegans Hypothetical pr...    46   3e-05
U39997-3|AAK68389.1|  498|Caenorhabditis elegans Human daz (dele...    46   3e-05
AB025253-1|BAA88577.1|  499|Caenorhabditis elegans DAZ-1 protein.      46   3e-05
U23484-3|AAK68298.1|  126|Caenorhabditis elegans Sr protein (spl...    45   5e-05
U23484-2|AAC46767.1|  196|Caenorhabditis elegans Sr protein (spl...    45   5e-05
Z81108-4|CAB03237.1|   85|Caenorhabditis elegans Hypothetical pr...    44   6e-05
U24123-1|AAA65224.1|  646|Caenorhabditis elegans polyadenylate-b...    44   1e-04
AL032631-4|CAE54917.1|  586|Caenorhabditis elegans Hypothetical ...    44   1e-04
AL032631-3|CAE54916.1|  583|Caenorhabditis elegans Hypothetical ...    44   1e-04
AL032631-2|CAA21572.1|  646|Caenorhabditis elegans Hypothetical ...    44   1e-04
U28944-7|AAN63457.1|  295|Caenorhabditis elegans Hypothetical pr...    43   1e-04
U28944-6|AAN63456.1|  305|Caenorhabditis elegans Hypothetical pr...    43   1e-04
U28944-5|AAK68191.1|  408|Caenorhabditis elegans Hypothetical pr...    43   1e-04
U28944-4|AAK68192.1|  376|Caenorhabditis elegans Hypothetical pr...    43   1e-04
Z92826-4|CAB07322.1|  309|Caenorhabditis elegans Hypothetical pr...    42   2e-04
AC024818-2|AAF60781.1|  302|Caenorhabditis elegans Temporarily a...    42   3e-04
Z81106-3|CAB03222.1|   84|Caenorhabditis elegans Hypothetical pr...    42   4e-04
Z68297-5|CAC70081.1|  394|Caenorhabditis elegans Hypothetical pr...    42   4e-04
Z83119-2|CAB05579.2|  608|Caenorhabditis elegans Hypothetical pr...    41   6e-04
Z46676-8|CAB60993.2|  388|Caenorhabditis elegans Hypothetical pr...    40   0.002
U24189-3|AAC47514.1|  398|Caenorhabditis elegans RRM-type RNA bi...    40   0.002
Z66521-4|CAD59160.1|  150|Caenorhabditis elegans Hypothetical pr...    39   0.002
Z66521-3|CAD59159.1|  148|Caenorhabditis elegans Hypothetical pr...    39   0.002
Z66521-2|CAA91395.1|  312|Caenorhabditis elegans Hypothetical pr...    39   0.002
Z97628-2|CAB10726.2|  427|Caenorhabditis elegans Hypothetical pr...    39   0.003
Z81080-5|CAB03088.2|  427|Caenorhabditis elegans Hypothetical pr...    39   0.003
Z81080-2|CAD56584.1|  358|Caenorhabditis elegans Hypothetical pr...    39   0.003
AL110485-8|CAB60356.1|  434|Caenorhabditis elegans Hypothetical ...    39   0.003
AC024826-10|AAM97977.1|  435|Caenorhabditis elegans Hypothetical...    38   0.004
AC024826-8|AAF60795.2|  580|Caenorhabditis elegans Hypothetical ...    38   0.004
AF038623-4|AAO91699.1|  177|Caenorhabditis elegans Hypothetical ...    38   0.005
Z81473-3|CAB03896.4|  514|Caenorhabditis elegans Hypothetical pr...    38   0.007
AY342388-1|AAQ19851.1|  514|Caenorhabditis elegans putative RNA-...    38   0.007
Z81037-3|CAB02750.1|  205|Caenorhabditis elegans Hypothetical pr...    37   0.012
Z66521-8|CAA91394.1|  281|Caenorhabditis elegans Hypothetical pr...    37   0.012
AL137227-1|CAB70238.2|  611|Caenorhabditis elegans Hypothetical ...    36   0.016
Z73102-13|CAA97405.1|  836|Caenorhabditis elegans Hypothetical p...    35   0.037
Z36238-3|CAA85276.1|  404|Caenorhabditis elegans Hypothetical pr...    35   0.037
DQ485531-1|ABF22491.1|  404|Caenorhabditis elegans RNA-binding p...    35   0.037
Z50874-3|CAA90773.1|  409|Caenorhabditis elegans Hypothetical pr...    35   0.049
Z50874-2|CAA90772.1|  357|Caenorhabditis elegans Hypothetical pr...    35   0.049
Z50044-2|CAA90354.1|  256|Caenorhabditis elegans Hypothetical pr...    34   0.065
U79157-1|AAC26982.1|  496|Caenorhabditis elegans splicing factor...    34   0.086
U41531-7|AAA83161.2|  415|Caenorhabditis elegans Feminizing gene...    34   0.086
U14946-1|AAA67723.1|  415|Caenorhabditis elegans ribonucleoprote...    34   0.086
AC024875-3|AAK29989.1|  496|Caenorhabditis elegans U2af splicing...    34   0.086
AC024875-2|AAM44400.1|  471|Caenorhabditis elegans U2af splicing...    34   0.086
AC024875-1|AAL00879.1|  474|Caenorhabditis elegans U2af splicing...    34   0.086
AL132904-14|CAC35847.2|  258|Caenorhabditis elegans Hypothetical...    33   0.11 
AF242767-1|AAG36874.1|  258|Caenorhabditis elegans SF2 protein.        33   0.11 
U23484-7|ABB88232.1|  738|Caenorhabditis elegans Hypothetical pr...    33   0.15 
AC024791-23|AAM81102.1|  346|Caenorhabditis elegans Rnp (rrm rna...    33   0.15 
AC024791-22|AAF60676.1|  339|Caenorhabditis elegans Rnp (rrm rna...    33   0.15 
AC024791-21|AAF60666.1|  749|Caenorhabditis elegans Rnp (rrm rna...    33   0.15 
Z75552-9|CAA99945.2|  705|Caenorhabditis elegans Hypothetical pr...    33   0.20 
Z75551-6|CAA99937.2|  705|Caenorhabditis elegans Hypothetical pr...    33   0.20 
Z78419-2|CAB01702.1|  154|Caenorhabditis elegans Hypothetical pr...    32   0.26 
U41007-9|AAL32213.1|  153|Caenorhabditis elegans Sr protein (spl...    32   0.35 
Z81120-1|CAB03342.1|  207|Caenorhabditis elegans Hypothetical pr...    31   0.61 
U41007-10|AAL32214.1|  118|Caenorhabditis elegans Sr protein (sp...    31   0.61 
U41007-8|AAA82270.1|  179|Caenorhabditis elegans Sr protein (spl...    31   0.61 
Z78019-5|CAB01455.1|  305|Caenorhabditis elegans Hypothetical pr...    30   1.4  
U21302-2|AAA92287.1|  305|Caenorhabditis elegans RNP-1 protein.        30   1.4  
Z36238-4|CAD82915.1|  286|Caenorhabditis elegans Hypothetical pr...    29   1.9  
AJ297847-1|CAC16732.1|  619|Caenorhabditis elegans FOG-1 protein...    29   3.2  
AJ297846-1|CAC16731.1|  619|Caenorhabditis elegans FOG-1 protein...    29   3.2  
AC024810-12|AAK68519.1|  619|Caenorhabditis elegans Feminization...    29   3.2  
Z81064-7|CAB02960.2|  382|Caenorhabditis elegans Hypothetical pr...    28   4.3  
U23450-1|AAK31467.2|  422|Caenorhabditis elegans Cpeb polya bind...    28   4.3  
AL031621-7|CAE46665.1|  382|Caenorhabditis elegans Hypothetical ...    28   4.3  
U23172-15|AAN63408.1|  374|Caenorhabditis elegans Hypothetical p...    28   5.7  
U23172-14|AAL02495.1|  165|Caenorhabditis elegans Hypothetical p...    28   5.7  
U23172-12|ABH03526.1|  562|Caenorhabditis elegans Hypothetical p...    28   5.7  
Z81139-8|CAB03483.2|  361|Caenorhabditis elegans Hypothetical pr...    27   7.5  
Z81062-15|CAB02950.2|  361|Caenorhabditis elegans Hypothetical p...    27   7.5  
AF003145-3|AAB57717.1|  751|Caenorhabditis elegans Cpeb polya bi...    27   7.5  
Z82094-3|CAB05024.1| 2561|Caenorhabditis elegans Hypothetical pr...    27   9.9  
Z81120-8|CAB03348.1| 2561|Caenorhabditis elegans Hypothetical pr...    27   9.9  
Z19154-9|CAA79552.2|  559|Caenorhabditis elegans Hypothetical pr...    27   9.9  

>Z35601-1|CAA84667.2|  320|Caenorhabditis elegans Hypothetical
           protein R10E9.1 protein.
          Length = 320

 Score =  126 bits (305), Expect = 9e-30
 Identities = 62/129 (48%), Positives = 85/129 (65%), Gaps = 5/129 (3%)
 Frame = +2

Query: 53  RMNPDMDD-----DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGF 217
           R+N D DD      + GK+F+GGLSW+T+ ENL+ YF R+GEV +C+VM++  + R+RGF
Sbjct: 29  RLNADSDDGSHGSQDPGKMFIGGLSWQTTAENLRDYFGRFGEVNECMVMRDPATKRARGF 88

Query: 218 GFVTFADPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTE 397
           GF+TF DPS V+ VL N  H+LDG+ IDPK   P+  Q  K      KVF+GGL +  T 
Sbjct: 89  GFITFVDPSSVDKVLNNREHELDGKKIDPKVAFPKRTQ-AKLVTKTKKVFIGGLSATSTL 147

Query: 398 TDLRXIFRT 424
            D++  F T
Sbjct: 148 EDMKQYFET 156



 Score = 67.7 bits (158), Expect = 6e-12
 Identities = 29/83 (34%), Positives = 53/83 (63%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+F+GGLS  ++ E++++YF  YG+V D ++M +  + R RGFGFVTF    + + V + 
Sbjct: 135 KVFIGGLSATSTLEDMKQYFETYGKVEDAMLMFDKATQRHRGFGFVTFDSDEVADKVCEI 194

Query: 269 GPHQLDGRTIDPKPCNPRTLQKP 337
             H+++G+ ++ K   P+ +  P
Sbjct: 195 HFHEINGKMVECKKAQPKEVMLP 217



 Score = 38.3 bits (85), Expect = 0.004
 Identities = 15/35 (42%), Positives = 24/35 (68%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           +FGR+G+V E ++M D   K++ G GF++F D  S
Sbjct: 64  YFGRFGEVNECMVMRDPATKRARGFGFITFVDPSS 98



 Score = 33.9 bits (74), Expect = 0.086
 Identities = 11/33 (33%), Positives = 23/33 (69%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDE 512
           +F  YGKV + ++M+D+  ++  G GF++F+ +
Sbjct: 153 YFETYGKVEDAMLMFDKATQRHRGFGFVTFDSD 185


>AB036738-1|BAB13470.1|  320|Caenorhabditis elegans neural
           RNA-binding protein MSI-1 protein.
          Length = 320

 Score =  126 bits (305), Expect = 9e-30
 Identities = 62/129 (48%), Positives = 85/129 (65%), Gaps = 5/129 (3%)
 Frame = +2

Query: 53  RMNPDMDD-----DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGF 217
           R+N D DD      + GK+F+GGLSW+T+ ENL+ YF R+GEV +C+VM++  + R+RGF
Sbjct: 29  RLNADSDDGSHGSQDPGKMFIGGLSWQTTAENLRDYFGRFGEVNECMVMRDPATKRARGF 88

Query: 218 GFVTFADPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTE 397
           GF+TF DPS V+ VL N  H+LDG+ IDPK   P+  Q  K      KVF+GGL +  T 
Sbjct: 89  GFITFVDPSSVDKVLNNREHELDGKKIDPKVAFPKRTQ-AKLVTKTKKVFIGGLSATSTL 147

Query: 398 TDLRXIFRT 424
            D++  F T
Sbjct: 148 EDMKQYFET 156



 Score = 67.7 bits (158), Expect = 6e-12
 Identities = 29/83 (34%), Positives = 53/83 (63%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+F+GGLS  ++ E++++YF  YG+V D ++M +  + R RGFGFVTF    + + V + 
Sbjct: 135 KVFIGGLSATSTLEDMKQYFETYGKVEDAMLMFDKATQRHRGFGFVTFDSDEVADKVCEI 194

Query: 269 GPHQLDGRTIDPKPCNPRTLQKP 337
             H+++G+ ++ K   P+ +  P
Sbjct: 195 HFHEINGKMVECKKAQPKEVMLP 217



 Score = 38.3 bits (85), Expect = 0.004
 Identities = 15/35 (42%), Positives = 24/35 (68%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           +FGR+G+V E ++M D   K++ G GF++F D  S
Sbjct: 64  YFGRFGEVNECMVMRDPATKRARGFGFITFVDPSS 98



 Score = 33.9 bits (74), Expect = 0.086
 Identities = 11/33 (33%), Positives = 23/33 (69%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDE 512
           +F  YGKV + ++M+D+  ++  G GF++F+ +
Sbjct: 153 YFETYGKVEDAMLMFDKATQRHRGFGFVTFDSD 185


>D10877-1|BAA01645.1|  346|Caenorhabditis elegans hnRNP like protein
           protein.
          Length = 346

 Score = 86.2 bits (204), Expect = 2e-17
 Identities = 39/118 (33%), Positives = 73/118 (61%), Gaps = 1/118 (0%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSL 247
           ++ +   K+FVGGL+  T+ + ++ ++S++GE+ D +VM++  + RSRGFGFVTF+  + 
Sbjct: 17  LEPENLRKIFVGGLTSNTTDDLMREFYSQFGEITDIIVMRDPTTKRSRGFGFVTFSGKTE 76

Query: 248 VNLVLQNGPHQLDGRTIDPKPCNPR-TLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
           V+  ++  PH +DG+T+DPK   PR    + +      ++++ G+  + TE  L   F
Sbjct: 77  VDAAMKQRPHIIDGKTVDPKRAVPRDDKNRSESNVSTKRLYVSGVREDHTEDMLTEYF 134



 Score = 49.6 bits (113), Expect = 2e-06
 Identities = 22/71 (30%), Positives = 40/71 (56%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           +L+V G+  + +++ L  YF++YG V    ++ +  + + RGFGFVTF D   V+  +  
Sbjct: 115 RLYVSGVREDHTEDMLTEYFTKYGTVTKSEIILDKATQKPRGFGFVTFDDHDSVDQCVLQ 174

Query: 269 GPHQLDGRTID 301
             H ++G   D
Sbjct: 175 KSHMVNGHRCD 185



 Score = 37.5 bits (83), Expect = 0.007
 Identities = 22/71 (30%), Positives = 38/71 (53%), Gaps = 1/71 (1%)
 Frame = +3

Query: 309 RAILALFKNRNVA-VDTLRCSLAGCHRTLPKPISGXFFGRYGKVMEVVIMYDQXKKKSXG 485
           RA+    KNR+ + V T R  ++G      + +   +F +YG V +  I+ D+  +K  G
Sbjct: 97  RAVPRDDKNRSESNVSTKRLYVSGVREDHTEDMLTEYFTKYGTVTKSEIILDKATQKPRG 156

Query: 486 XGFLSFEDEXS 518
            GF++F+D  S
Sbjct: 157 FGFVTFDDHDS 167


>AF038613-6|ABB51186.1|  347|Caenorhabditis elegans Human hnrnp a1
           homolog protein1, isoform d protein.
          Length = 347

 Score = 86.2 bits (204), Expect = 2e-17
 Identities = 39/118 (33%), Positives = 73/118 (61%), Gaps = 1/118 (0%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSL 247
           ++ +   K+FVGGL+  T+ + ++ ++S++GE+ D +VM++  + RSRGFGFVTF+  + 
Sbjct: 17  LEPENLRKIFVGGLTSNTTDDLMREFYSQFGEITDIIVMRDPTTKRSRGFGFVTFSGKTE 76

Query: 248 VNLVLQNGPHQLDGRTIDPKPCNPR-TLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
           V+  ++  PH +DG+T+DPK   PR    + +      ++++ G+  + TE  L   F
Sbjct: 77  VDAAMKQRPHIIDGKTVDPKRAVPRDDKNRSESNVSTKRLYVSGVREDHTEDMLTEYF 134



 Score = 49.6 bits (113), Expect = 2e-06
 Identities = 22/71 (30%), Positives = 40/71 (56%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           +L+V G+  + +++ L  YF++YG V    ++ +  + + RGFGFVTF D   V+  +  
Sbjct: 115 RLYVSGVREDHTEDMLTEYFTKYGTVTKSEIILDKATQKPRGFGFVTFDDHDSVDQCVLQ 174

Query: 269 GPHQLDGRTID 301
             H ++G   D
Sbjct: 175 KSHMVNGHRCD 185



 Score = 37.5 bits (83), Expect = 0.007
 Identities = 22/71 (30%), Positives = 38/71 (53%), Gaps = 1/71 (1%)
 Frame = +3

Query: 309 RAILALFKNRNVA-VDTLRCSLAGCHRTLPKPISGXFFGRYGKVMEVVIMYDQXKKKSXG 485
           RA+    KNR+ + V T R  ++G      + +   +F +YG V +  I+ D+  +K  G
Sbjct: 97  RAVPRDDKNRSESNVSTKRLYVSGVREDHTEDMLTEYFTKYGTVTKSEIILDKATQKPRG 156

Query: 486 XGFLSFEDEXS 518
            GF++F+D  S
Sbjct: 157 FGFVTFDDHDS 167


>AF038613-5|AAB92051.1|  346|Caenorhabditis elegans Human hnrnp a1
           homolog protein1, isoform a protein.
          Length = 346

 Score = 86.2 bits (204), Expect = 2e-17
 Identities = 39/118 (33%), Positives = 73/118 (61%), Gaps = 1/118 (0%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSL 247
           ++ +   K+FVGGL+  T+ + ++ ++S++GE+ D +VM++  + RSRGFGFVTF+  + 
Sbjct: 17  LEPENLRKIFVGGLTSNTTDDLMREFYSQFGEITDIIVMRDPTTKRSRGFGFVTFSGKTE 76

Query: 248 VNLVLQNGPHQLDGRTIDPKPCNPR-TLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
           V+  ++  PH +DG+T+DPK   PR    + +      ++++ G+  + TE  L   F
Sbjct: 77  VDAAMKQRPHIIDGKTVDPKRAVPRDDKNRSESNVSTKRLYVSGVREDHTEDMLTEYF 134



 Score = 49.6 bits (113), Expect = 2e-06
 Identities = 22/71 (30%), Positives = 40/71 (56%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           +L+V G+  + +++ L  YF++YG V    ++ +  + + RGFGFVTF D   V+  +  
Sbjct: 115 RLYVSGVREDHTEDMLTEYFTKYGTVTKSEIILDKATQKPRGFGFVTFDDHDSVDQCVLQ 174

Query: 269 GPHQLDGRTID 301
             H ++G   D
Sbjct: 175 KSHMVNGHRCD 185



 Score = 37.5 bits (83), Expect = 0.007
 Identities = 22/71 (30%), Positives = 38/71 (53%), Gaps = 1/71 (1%)
 Frame = +3

Query: 309 RAILALFKNRNVA-VDTLRCSLAGCHRTLPKPISGXFFGRYGKVMEVVIMYDQXKKKSXG 485
           RA+    KNR+ + V T R  ++G      + +   +F +YG V +  I+ D+  +K  G
Sbjct: 97  RAVPRDDKNRSESNVSTKRLYVSGVREDHTEDMLTEYFTKYGTVTKSEIILDKATQKPRG 156

Query: 486 XGFLSFEDEXS 518
            GF++F+D  S
Sbjct: 157 FGFVTFDDHDS 167


>AF098501-6|AAL38960.1|  315|Caenorhabditis elegans Hypothetical
           protein H28G03.1b protein.
          Length = 315

 Score = 82.2 bits (194), Expect = 2e-16
 Identities = 36/78 (46%), Positives = 52/78 (66%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLF+GGLS +T+ E L  YFS++G V+D +V+++  +  SRGFGFVTFA        + +
Sbjct: 50  KLFIGGLSHDTTDEQLGNYFSQWGPVVDAIVIRDPNTKHSRGFGFVTFASIFSAESAMND 109

Query: 269 GPHQLDGRTIDPKPCNPR 322
            PH+L G+T+D K   PR
Sbjct: 110 RPHKLGGKTVDSKRAIPR 127


>AF098501-5|AAM69104.1|  335|Caenorhabditis elegans Hypothetical
           protein H28G03.1c protein.
          Length = 335

 Score = 82.2 bits (194), Expect = 2e-16
 Identities = 36/78 (46%), Positives = 52/78 (66%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLF+GGLS +T+ E L  YFS++G V+D +V+++  +  SRGFGFVTFA        + +
Sbjct: 70  KLFIGGLSHDTTDEQLGNYFSQWGPVVDAIVIRDPNTKHSRGFGFVTFASIFSAESAMND 129

Query: 269 GPHQLDGRTIDPKPCNPR 322
            PH+L G+T+D K   PR
Sbjct: 130 RPHKLGGKTVDSKRAIPR 147


>AF098501-4|AAL38959.1|  336|Caenorhabditis elegans Hypothetical
           protein H28G03.1a protein.
          Length = 336

 Score = 82.2 bits (194), Expect = 2e-16
 Identities = 36/78 (46%), Positives = 52/78 (66%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLF+GGLS +T+ E L  YFS++G V+D +V+++  +  SRGFGFVTFA        + +
Sbjct: 71  KLFIGGLSHDTTDEQLGNYFSQWGPVVDAIVIRDPNTKHSRGFGFVTFASIFSAESAMND 130

Query: 269 GPHQLDGRTIDPKPCNPR 322
            PH+L G+T+D K   PR
Sbjct: 131 RPHKLGGKTVDSKRAIPR 148


>AC084197-11|AAM44397.1|  305|Caenorhabditis elegans Homologous to
           drosophila sqd (squid)protein protein 1, isoform a
           protein.
          Length = 305

 Score = 77.8 bits (183), Expect = 5e-15
 Identities = 44/114 (38%), Positives = 63/114 (55%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNL 256
           +E  K+FVGG+S E + E+L  +F++YGEV    V  +  +GRSRGF FV F       L
Sbjct: 26  NEDKKIFVGGISPEVNNEDLSSHFTQYGEVAQAQVKYDRTNGRSRGFAFVEFTTGEGCKL 85

Query: 257 VLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
            L      + G++++ KP   R  +         KVF+GGLPS+ +E DLR  F
Sbjct: 86  ALAAREQTIKGKSVEVKPAKSRENK---------KVFVGGLPSDYSEQDLRSHF 130



 Score = 42.3 bits (95), Expect = 2e-04
 Identities = 24/93 (25%), Positives = 42/93 (45%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLV 259
           E  K+FVGGL  + S+++L+ +F ++G+V D     + ++   R F F+ F +    +  
Sbjct: 108 ENKKVFVGGLPSDYSEQDLRSHFEQFGKVDDIEWPFDKQTKARRNFAFIVFEEEESADKA 167

Query: 260 LQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYP 358
                     R  D K   P+  + P   G  P
Sbjct: 168 SSQTKQTFGTRECDVKKAVPQGKRFPGAQGRMP 200



 Score = 27.5 bits (58), Expect = 7.5
 Identities = 10/29 (34%), Positives = 17/29 (58%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSF 503
           F +YG+V +  + YD+   +S G  F+ F
Sbjct: 49  FTQYGEVAQAQVKYDRTNGRSRGFAFVEF 77


>AC084197-10|AAY43984.1|  308|Caenorhabditis elegans Homologous to
           drosophila sqd (squid)protein protein 1, isoform b
           protein.
          Length = 308

 Score = 77.8 bits (183), Expect = 5e-15
 Identities = 44/114 (38%), Positives = 63/114 (55%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNL 256
           +E  K+FVGG+S E + E+L  +F++YGEV    V  +  +GRSRGF FV F       L
Sbjct: 26  NEDKKIFVGGISPEVNNEDLSSHFTQYGEVAQAQVKYDRTNGRSRGFAFVEFTTGEGCKL 85

Query: 257 VLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
            L      + G++++ KP   R  +         KVF+GGLPS+ +E DLR  F
Sbjct: 86  ALAAREQTIKGKSVEVKPAKSRENK---------KVFVGGLPSDYSEQDLRSHF 130



 Score = 42.3 bits (95), Expect = 2e-04
 Identities = 24/93 (25%), Positives = 42/93 (45%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLV 259
           E  K+FVGGL  + S+++L+ +F ++G+V D     + ++   R F F+ F +    +  
Sbjct: 108 ENKKVFVGGLPSDYSEQDLRSHFEQFGKVDDIEWPFDKQTKARRNFAFIVFEEEESADKA 167

Query: 260 LQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYP 358
                     R  D K   P+  + P   G  P
Sbjct: 168 SSQTKQTFGTRECDVKKAVPQGKRFPGAQGRMP 200



 Score = 27.5 bits (58), Expect = 7.5
 Identities = 10/29 (34%), Positives = 17/29 (58%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSF 503
           F +YG+V +  + YD+   +S G  F+ F
Sbjct: 49  FTQYGEVAQAQVKYDRTNGRSRGFAFVEF 77


>AF038613-8|AAL02515.2|  309|Caenorhabditis elegans Human hnrnp a1
           homolog protein1, isoform b protein.
          Length = 309

 Score = 71.3 bits (167), Expect = 5e-13
 Identities = 32/96 (33%), Positives = 59/96 (61%), Gaps = 1/96 (1%)
 Frame = +2

Query: 134 LQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNGPHQLDGRTIDPKPC 313
           ++ ++S++GE+ D +VM++  + RSRGFGFVTF+  + V+  ++  PH +DG+T+DPK  
Sbjct: 1   MREFYSQFGEITDIIVMRDPTTKRSRGFGFVTFSGKTEVDAAMKQRPHIIDGKTVDPKRA 60

Query: 314 NPR-TLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
            PR    + +      ++++ G+  + TE  L   F
Sbjct: 61  VPRDDKNRSESNVSTKRLYVSGVREDHTEDMLTEYF 96



 Score = 49.6 bits (113), Expect = 2e-06
 Identities = 22/71 (30%), Positives = 40/71 (56%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           +L+V G+  + +++ L  YF++YG V    ++ +  + + RGFGFVTF D   V+  +  
Sbjct: 77  RLYVSGVREDHTEDMLTEYFTKYGTVTKSEIILDKATQKPRGFGFVTFDDHDSVDQCVLQ 136

Query: 269 GPHQLDGRTID 301
             H ++G   D
Sbjct: 137 KSHMVNGHRCD 147



 Score = 37.5 bits (83), Expect = 0.007
 Identities = 22/71 (30%), Positives = 38/71 (53%), Gaps = 1/71 (1%)
 Frame = +3

Query: 309 RAILALFKNRNVA-VDTLRCSLAGCHRTLPKPISGXFFGRYGKVMEVVIMYDQXKKKSXG 485
           RA+    KNR+ + V T R  ++G      + +   +F +YG V +  I+ D+  +K  G
Sbjct: 59  RAVPRDDKNRSESNVSTKRLYVSGVREDHTEDMLTEYFTKYGTVTKSEIILDKATQKPRG 118

Query: 486 XGFLSFEDEXS 518
            GF++F+D  S
Sbjct: 119 FGFVTFDDHDS 129


>AF038613-7|ABB51185.1|  308|Caenorhabditis elegans Human hnrnp a1
           homolog protein1, isoform c protein.
          Length = 308

 Score = 71.3 bits (167), Expect = 5e-13
 Identities = 32/96 (33%), Positives = 59/96 (61%), Gaps = 1/96 (1%)
 Frame = +2

Query: 134 LQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNGPHQLDGRTIDPKPC 313
           ++ ++S++GE+ D +VM++  + RSRGFGFVTF+  + V+  ++  PH +DG+T+DPK  
Sbjct: 1   MREFYSQFGEITDIIVMRDPTTKRSRGFGFVTFSGKTEVDAAMKQRPHIIDGKTVDPKRA 60

Query: 314 NPR-TLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
            PR    + +      ++++ G+  + TE  L   F
Sbjct: 61  VPRDDKNRSESNVSTKRLYVSGVREDHTEDMLTEYF 96



 Score = 49.6 bits (113), Expect = 2e-06
 Identities = 22/71 (30%), Positives = 40/71 (56%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           +L+V G+  + +++ L  YF++YG V    ++ +  + + RGFGFVTF D   V+  +  
Sbjct: 77  RLYVSGVREDHTEDMLTEYFTKYGTVTKSEIILDKATQKPRGFGFVTFDDHDSVDQCVLQ 136

Query: 269 GPHQLDGRTID 301
             H ++G   D
Sbjct: 137 KSHMVNGHRCD 147



 Score = 37.5 bits (83), Expect = 0.007
 Identities = 22/71 (30%), Positives = 38/71 (53%), Gaps = 1/71 (1%)
 Frame = +3

Query: 309 RAILALFKNRNVA-VDTLRCSLAGCHRTLPKPISGXFFGRYGKVMEVVIMYDQXKKKSXG 485
           RA+    KNR+ + V T R  ++G      + +   +F +YG V +  I+ D+  +K  G
Sbjct: 59  RAVPRDDKNRSESNVSTKRLYVSGVREDHTEDMLTEYFTKYGTVTKSEIILDKATQKPRG 118

Query: 486 XGFLSFEDEXS 518
            GF++F+D  S
Sbjct: 119 FGFVTFDDHDS 129


>Z49910-5|CAA90120.1|  411|Caenorhabditis elegans Hypothetical
           protein F44G4.4a protein.
          Length = 411

 Score = 64.5 bits (150), Expect = 5e-11
 Identities = 40/116 (34%), Positives = 59/116 (50%), Gaps = 1/116 (0%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           D +   L V G+ ++T+ E  Q+YF   G V+ C + + S+ G S+GFGFV  +     N
Sbjct: 169 DSQPVDLIVLGVDFKTTDECFQKYFEDIGTVVFCEIKRKSD-GNSKGFGFVRMSSVGEQN 227

Query: 254 LVLQNGPHQLDGRTIDPKPCNPRTLQ-KPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
            VL    H +DGR  D K  + R  Q +P       ++F+G L   V E  LR +F
Sbjct: 228 KVLAIPQHMIDGRRCDVKVPDGRDKQGRP----SISRIFVGRLTDKVDEHQLRKVF 279



 Score = 28.7 bits (61), Expect = 3.2
 Identities = 20/91 (21%), Positives = 39/91 (42%), Gaps = 2/91 (2%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGE-VIDCVVMKNSESGRS-RGFGFVTFADPSLVNLVL 262
           ++FVG L+ +  +  L++ F    +  I+  V+ +    +  RGF FVT +       ++
Sbjct: 260 RIFVGRLTDKVDEHQLRKVFGDEAKSYIETAVVTDVFIPKPFRGFAFVTLSSAEAAERIV 319

Query: 263 QNGPHQLDGRTIDPKPCNPRTLQKPKRGGGY 355
             G   ++G ++      PR       G  Y
Sbjct: 320 SKGSLTVNGLSVGLSIAQPREENNQSVGPDY 350


>AF047662-1|AAC04442.1|  248|Caenorhabditis elegans Suppressor
           protein 12 protein.
          Length = 248

 Score = 58.0 bits (134), Expect = 5e-09
 Identities = 25/68 (36%), Positives = 42/68 (61%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGGL + TS + L  YF ++G++ + VV+ +  + +SRG+GFVT  D +      ++
Sbjct: 36  KIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKD 95

Query: 269 GPHQLDGR 292
               +DGR
Sbjct: 96  PNPIIDGR 103


>U80455-1|AAB37881.1|  584|Caenorhabditis elegans Elav-type rna
           binding protein familyprotein 1, isoform a protein.
          Length = 584

 Score = 55.6 bits (128), Expect = 2e-08
 Identities = 26/66 (39%), Positives = 46/66 (69%), Gaps = 1/66 (1%)
 Frame = +2

Query: 50  MRMNP-DMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFV 226
           ++M P D ++  + KLF+G LS + ++ENL+  F+++G + DC V+++ + G+SRG  FV
Sbjct: 129 VQMKPADTENRNERKLFIGQLSKKHNEENLREIFAKFGHIEDCSVLRD-QDGKSRGCAFV 187

Query: 227 TFADPS 244
           TF + S
Sbjct: 188 TFTNRS 193



 Score = 46.8 bits (106), Expect = 1e-05
 Identities = 36/128 (28%), Positives = 62/128 (48%), Gaps = 8/128 (6%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF-- 232
           +P   D +  K+FVG +  + ++ + +R F +YG V  C ++++  +  S+G  FVTF  
Sbjct: 46  SPSEPDTDAIKMFVGQIPRQWNETDCRRLFEKYGSVFSCNILRDKSTQASKGCCFVTFYH 105

Query: 233 ------ADPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVT 394
                 A  +L N+ +  G H      +  KP +  T  + +R     K+F+G L     
Sbjct: 106 RKDAIEAQGALHNIKVIEGMH----HPVQMKPAD--TENRNER-----KLFIGQLSKKHN 154

Query: 395 ETDLRXIF 418
           E +LR IF
Sbjct: 155 EENLREIF 162


>U53931-1|AAA98566.1|  584|Caenorhabditis elegans elav-type
           ribonucleoprotein protein.
          Length = 584

 Score = 55.6 bits (128), Expect = 2e-08
 Identities = 26/66 (39%), Positives = 46/66 (69%), Gaps = 1/66 (1%)
 Frame = +2

Query: 50  MRMNP-DMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFV 226
           ++M P D ++  + KLF+G LS + ++ENL+  F+++G + DC V+++ + G+SRG  FV
Sbjct: 129 VQMKPADTENRNERKLFIGQLSKKHNEENLREIFAKFGHIEDCSVLRD-QDGKSRGCAFV 187

Query: 227 TFADPS 244
           TF + S
Sbjct: 188 TFTNRS 193



 Score = 46.8 bits (106), Expect = 1e-05
 Identities = 36/128 (28%), Positives = 62/128 (48%), Gaps = 8/128 (6%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF-- 232
           +P   D +  K+FVG +  + ++ + +R F +YG V  C ++++  +  S+G  FVTF  
Sbjct: 46  SPSEPDTDAIKMFVGQIPRQWNETDCRRLFEKYGSVFSCNILRDKSTQASKGCCFVTFYH 105

Query: 233 ------ADPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVT 394
                 A  +L N+ +  G H      +  KP +  T  + +R     K+F+G L     
Sbjct: 106 RKDAIEAQGALHNIKVIEGMH----HPVQMKPAD--TENRNER-----KLFIGQLSKKHN 154

Query: 395 ETDLRXIF 418
           E +LR IF
Sbjct: 155 EENLREIF 162


>EF523770-1|ABS18836.1|  513|Caenorhabditis elegans ELAV-type RNA
           binding protein variantE protein.
          Length = 513

 Score = 55.6 bits (128), Expect = 2e-08
 Identities = 26/66 (39%), Positives = 46/66 (69%), Gaps = 1/66 (1%)
 Frame = +2

Query: 50  MRMNP-DMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFV 226
           ++M P D ++  + KLF+G LS + ++ENL+  F+++G + DC V+++ + G+SRG  FV
Sbjct: 129 VQMKPADTENRNERKLFIGQLSKKHNEENLREIFAKFGHIEDCSVLRD-QDGKSRGCAFV 187

Query: 227 TFADPS 244
           TF + S
Sbjct: 188 TFTNRS 193



 Score = 46.8 bits (106), Expect = 1e-05
 Identities = 36/128 (28%), Positives = 62/128 (48%), Gaps = 8/128 (6%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF-- 232
           +P   D +  K+FVG +  + ++ + +R F +YG V  C ++++  +  S+G  FVTF  
Sbjct: 46  SPSEPDTDAIKMFVGQIPRQWNETDCRRLFEKYGSVFSCNILRDKSTQASKGCCFVTFYH 105

Query: 233 ------ADPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVT 394
                 A  +L N+ +  G H      +  KP +  T  + +R     K+F+G L     
Sbjct: 106 RKDAIEAQGALHNIKVIEGMH----HPVQMKPAD--TENRNER-----KLFIGQLSKKHN 154

Query: 395 ETDLRXIF 418
           E +LR IF
Sbjct: 155 EENLREIF 162


>EF523769-1|ABS18835.1|  327|Caenorhabditis elegans ELAV-type RNA
           binding protein variantD protein.
          Length = 327

 Score = 55.6 bits (128), Expect = 2e-08
 Identities = 26/66 (39%), Positives = 46/66 (69%), Gaps = 1/66 (1%)
 Frame = +2

Query: 50  MRMNP-DMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFV 226
           ++M P D ++  + KLF+G LS + ++ENL+  F+++G + DC V+++ + G+SRG  FV
Sbjct: 129 VQMKPADTENRNERKLFIGQLSKKHNEENLREIFAKFGHIEDCSVLRD-QDGKSRGCAFV 187

Query: 227 TFADPS 244
           TF + S
Sbjct: 188 TFTNRS 193



 Score = 46.8 bits (106), Expect = 1e-05
 Identities = 36/128 (28%), Positives = 62/128 (48%), Gaps = 8/128 (6%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF-- 232
           +P   D +  K+FVG +  + ++ + +R F +YG V  C ++++  +  S+G  FVTF  
Sbjct: 46  SPSEPDTDAIKMFVGQIPRQWNETDCRRLFEKYGSVFSCNILRDKSTQASKGCCFVTFYH 105

Query: 233 ------ADPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVT 394
                 A  +L N+ +  G H      +  KP +  T  + +R     K+F+G L     
Sbjct: 106 RKDAIEAQGALHNIKVIEGMH----HPVQMKPAD--TENRNER-----KLFIGQLSKKHN 154

Query: 395 ETDLRXIF 418
           E +LR IF
Sbjct: 155 EENLREIF 162


>EF523768-1|ABS18834.1|  378|Caenorhabditis elegans ELAV-type RNA
           binding protein variantC protein.
          Length = 378

 Score = 55.6 bits (128), Expect = 2e-08
 Identities = 26/66 (39%), Positives = 46/66 (69%), Gaps = 1/66 (1%)
 Frame = +2

Query: 50  MRMNP-DMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFV 226
           ++M P D ++  + KLF+G LS + ++ENL+  F+++G + DC V+++ + G+SRG  FV
Sbjct: 129 VQMKPADTENRNERKLFIGQLSKKHNEENLREIFAKFGHIEDCSVLRD-QDGKSRGCAFV 187

Query: 227 TFADPS 244
           TF + S
Sbjct: 188 TFTNRS 193



 Score = 46.8 bits (106), Expect = 1e-05
 Identities = 36/128 (28%), Positives = 62/128 (48%), Gaps = 8/128 (6%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF-- 232
           +P   D +  K+FVG +  + ++ + +R F +YG V  C ++++  +  S+G  FVTF  
Sbjct: 46  SPSEPDTDAIKMFVGQIPRQWNETDCRRLFEKYGSVFSCNILRDKSTQASKGCCFVTFYH 105

Query: 233 ------ADPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVT 394
                 A  +L N+ +  G H      +  KP +  T  + +R     K+F+G L     
Sbjct: 106 RKDAIEAQGALHNIKVIEGMH----HPVQMKPAD--TENRNER-----KLFIGQLSKKHN 154

Query: 395 ETDLRXIF 418
           E +LR IF
Sbjct: 155 EENLREIF 162


>EF523766-1|ABS18832.1|  584|Caenorhabditis elegans ELAV-type RNA
           binding protein variantA protein.
          Length = 584

 Score = 55.6 bits (128), Expect = 2e-08
 Identities = 26/66 (39%), Positives = 46/66 (69%), Gaps = 1/66 (1%)
 Frame = +2

Query: 50  MRMNP-DMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFV 226
           ++M P D ++  + KLF+G LS + ++ENL+  F+++G + DC V+++ + G+SRG  FV
Sbjct: 129 VQMKPADTENRNERKLFIGQLSKKHNEENLREIFAKFGHIEDCSVLRD-QDGKSRGCAFV 187

Query: 227 TFADPS 244
           TF + S
Sbjct: 188 TFTNRS 193



 Score = 46.8 bits (106), Expect = 1e-05
 Identities = 36/128 (28%), Positives = 62/128 (48%), Gaps = 8/128 (6%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF-- 232
           +P   D +  K+FVG +  + ++ + +R F +YG V  C ++++  +  S+G  FVTF  
Sbjct: 46  SPSEPDTDAIKMFVGQIPRQWNETDCRRLFEKYGSVFSCNILRDKSTQASKGCCFVTFYH 105

Query: 233 ------ADPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVT 394
                 A  +L N+ +  G H      +  KP +  T  + +R     K+F+G L     
Sbjct: 106 RKDAIEAQGALHNIKVIEGMH----HPVQMKPAD--TENRNER-----KLFIGQLSKKHN 154

Query: 395 ETDLRXIF 418
           E +LR IF
Sbjct: 155 EENLREIF 162


>Z77654-1|CAB01127.1|  114|Caenorhabditis elegans Hypothetical
           protein C50B8.1 protein.
          Length = 114

 Score = 54.8 bits (126), Expect = 4e-08
 Identities = 23/84 (27%), Positives = 42/84 (50%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           +++  + W T +  L+ YF RYG +    +  + ++G  RGF  +TF      N  ++  
Sbjct: 27  VYLTHVKWVTGKSQLEHYFKRYGSIQSVNMFYDPDTGLHRGFASITFDSKDGANKAIEQR 86

Query: 272 PHQLDGRTIDPKPCNPRTLQKPKR 343
           PH +DG  +D +P  P   +  K+
Sbjct: 87  PHVIDGDRVDVEPYIPLISKNKKK 110


>Z83230-6|CAB05746.1|  336|Caenorhabditis elegans Hypothetical
           protein F56A8.6 protein.
          Length = 336

 Score = 53.2 bits (122), Expect = 1e-07
 Identities = 21/77 (27%), Positives = 47/77 (61%), Gaps = 1/77 (1%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV 250
           +D  +  +FVG +S++ S++ ++  FS+ G V+   ++ + E+G+ +G+GF+ F D    
Sbjct: 13  NDRSQRSVFVGNISYDVSEDTIRSIFSKAGNVLSIKMVHDRETGKPKGYGFIEFPDIQTA 72

Query: 251 NLVLQN-GPHQLDGRTI 298
            + ++N   ++L GR +
Sbjct: 73  EVAIRNLNGYELSGRIL 89


>U21320-5|AAA62536.2|  332|Caenorhabditis elegans Rnp (rrm rna
           binding domain) containingprotein 7 protein.
          Length = 332

 Score = 53.2 bits (122), Expect = 1e-07
 Identities = 30/101 (29%), Positives = 56/101 (55%), Gaps = 3/101 (2%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           NP   +D    LFVG +++ETS+  L+R F  YG+ I  + M + E+G+ RG+ F+ ++D
Sbjct: 95  NPRASEDPYRTLFVGRINYETSESKLRREFEAYGK-IKKLTMVHDEAGKPRGYAFIEYSD 153

Query: 239 PSLVNLVLQNGPH-QLDGR--TIDPKPCNPRTLQKPKRGGG 352
            + ++   +     ++DG+   +D +    +    P+R GG
Sbjct: 154 KAEMHTAYKKADGIKVDGKRLVVDYERGRTQKTWLPRRLGG 194


>U23450-2|AAK31468.1|  302|Caenorhabditis elegans Hypothetical
           protein C30B5.4 protein.
          Length = 302

 Score = 49.2 bits (112), Expect = 2e-06
 Identities = 19/59 (32%), Positives = 40/59 (67%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           +++GGLS+  S+ ++   FS+YGEV++  ++++ ++G+S+GF F+ + D     L + N
Sbjct: 40  IYIGGLSYALSEGDVIAVFSQYGEVMNINLIRDKDTGKSKGFAFLCYKDQRSTILAVDN 98


>AL117204-22|CAB55151.1|  331|Caenorhabditis elegans Hypothetical
           protein Y116A8C.34 protein.
          Length = 331

 Score = 48.4 bits (110), Expect = 4e-06
 Identities = 26/82 (31%), Positives = 44/82 (53%), Gaps = 1/82 (1%)
 Frame = +2

Query: 56  MNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFA 235
           MN +   + K  L+VGG + + +++ L   F  +G+V+   +  + ESG+ RGFGFV F 
Sbjct: 1   MNTNFPHNRKRTLYVGGFTEDVTEKVLMAAFIPFGDVVAISIPMDYESGKHRGFGFVEFD 60

Query: 236 DPSLVNLVLQN-GPHQLDGRTI 298
                 + + N    +L G+TI
Sbjct: 61  MAEDAAMAIDNMNESELFGKTI 82


>Z78536-3|CAB01717.2|  360|Caenorhabditis elegans Hypothetical
           protein C07A4.1 protein.
          Length = 360

 Score = 46.8 bits (106), Expect = 1e-05
 Identities = 21/59 (35%), Positives = 39/59 (66%)
 Frame = +2

Query: 56  MNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           M   +D  +   +FVG LS + S E L+  F+++GEV +  V+++ ++ +S+G+GFV+F
Sbjct: 125 MEMRIDTSKHFHVFVGDLSKDVSNELLKSTFTKFGEVSEAKVIRDVQTQKSKGYGFVSF 183



 Score = 28.3 bits (60), Expect = 4.3
 Identities = 10/32 (31%), Positives = 21/32 (65%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMK 187
           ++VG +S +T+  +L+  FS YG++ +  + K
Sbjct: 239 VYVGNISQQTTDADLRDLFSTYGDIAEVRIFK 270


>EF523767-1|ABS18833.1|  193|Caenorhabditis elegans ELAV-type RNA
           binding protein variantB protein.
          Length = 193

 Score = 46.8 bits (106), Expect = 1e-05
 Identities = 36/128 (28%), Positives = 62/128 (48%), Gaps = 8/128 (6%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF-- 232
           +P   D +  K+FVG +  + ++ + +R F +YG V  C ++++  +  S+G  FVTF  
Sbjct: 46  SPSEPDTDAIKMFVGQIPRQWNETDCRRLFEKYGSVFSCNILRDKSTQASKGCCFVTFYH 105

Query: 233 ------ADPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVT 394
                 A  +L N+ +  G H      +  KP +  T  + +R     K+F+G L     
Sbjct: 106 RKDAIEAQGALHNIKVIEGMH----HPVQMKPAD--TENRNER-----KLFIGQLSKKHN 154

Query: 395 ETDLRXIF 418
           E +LR IF
Sbjct: 155 EENLREIF 162



 Score = 46.8 bits (106), Expect = 1e-05
 Identities = 21/56 (37%), Positives = 40/56 (71%), Gaps = 1/56 (1%)
 Frame = +2

Query: 50  MRMNP-DMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRG 214
           ++M P D ++  + KLF+G LS + ++ENL+  F+++G + DC V+++ + G+SRG
Sbjct: 129 VQMKPADTENRNERKLFIGQLSKKHNEENLREIFAKFGHIEDCSVLRD-QDGKSRG 183


>Z36752-6|CAA85327.1|  456|Caenorhabditis elegans Hypothetical
           protein F35H8.5 protein.
          Length = 456

 Score = 46.0 bits (104), Expect = 2e-05
 Identities = 32/122 (26%), Positives = 60/122 (49%), Gaps = 2/122 (1%)
 Frame = +2

Query: 62  PDMDDDE-KGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFA- 235
           P++D  E K  L +  L    +QE ++  F+  GE+  C ++++  +G+S G+GFV +  
Sbjct: 33  PNVDIGESKTNLIINYLPQGMTQEEVRSLFTSIGEIESCKLVRDKVTGQSLGYGFVNYVR 92

Query: 236 DPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXI 415
           +   +  V      +L  +TI      P   Q   +G     +++ G+P ++T  +L  I
Sbjct: 93  EEDALRAVSSFNGLRLQNKTIKVSYARPSNDQ--IKGS---NLYVSGIPKSMTLHELESI 147

Query: 416 FR 421
           FR
Sbjct: 148 FR 149



 Score = 37.1 bits (82), Expect = 0.009
 Identities = 16/57 (28%), Positives = 30/57 (52%)
 Frame = +2

Query: 62  PDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           P  D  +   L+V G+    +   L+  F  +G++I   ++ ++ +G S+G GFV F
Sbjct: 120 PSNDQIKGSNLYVSGIPKSMTLHELESIFRPFGQIITSRILSDNVTGLSKGVGFVRF 176


>Z83127-4|CAB05631.1|  872|Caenorhabditis elegans Hypothetical
           protein T23F6.4 protein.
          Length = 872

 Score = 45.6 bits (103), Expect = 3e-05
 Identities = 20/54 (37%), Positives = 33/54 (61%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADP 241
           E G+LF+  L + T +++LQ  F +YGEV +  V+ + ++G  +GF  V F  P
Sbjct: 277 ETGRLFLRNLPYATKEDDLQFLFKKYGEVSEVQVVIDKKTGACKGFAIVEFVFP 330



 Score = 31.1 bits (67), Expect = 0.61
 Identities = 18/55 (32%), Positives = 27/55 (49%), Gaps = 1/55 (1%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKN-SESGRSRGFGFVTF 232
           +  E  KL V  L +E S + ++  F  +G V    + K   +  + RGFGFV F
Sbjct: 743 EQGECTKLLVRNLPFEASVKEVETLFETFGAVKTIRIPKKPGQKQQHRGFGFVDF 797


>Z81108-1|CAB03236.1|   83|Caenorhabditis elegans Hypothetical
           protein R09B3.2 protein.
          Length = 83

 Score = 45.6 bits (103), Expect = 3e-05
 Identities = 22/70 (31%), Positives = 41/70 (58%), Gaps = 1/70 (1%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADP-SLVNLVLQN 268
           ++VG   ++T++E L  +FS  G++ +  ++ + E+GR RGF F+ FA+  S    V Q 
Sbjct: 7   VYVGNAPFQTTEEELGNFFSSIGQINNVRIVCDRETGRPRGFAFIEFAEEGSAQRAVEQM 66

Query: 269 GPHQLDGRTI 298
              + +GR +
Sbjct: 67  NGAEFNGRPL 76


>Z50110-2|CAA90446.1|  566|Caenorhabditis elegans Hypothetical
           protein F18H3.3b protein.
          Length = 566

 Score = 45.6 bits (103), Expect = 3e-05
 Identities = 21/49 (42%), Positives = 30/49 (61%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           +FV        QE L   FS++GE+   VVM +++ G+ +GFGFV FAD
Sbjct: 240 VFVKNFGEHLDQEKLSAMFSKFGEITSAVVMTDAQ-GKPKGFGFVAFAD 287



 Score = 41.1 bits (92), Expect = 6e-04
 Identities = 19/50 (38%), Positives = 31/50 (62%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADP 241
           L+V  +  + + + L+ +FS +G +    VM + E+GRS+GFGFV F  P
Sbjct: 345 LYVKNIEEDLNDDGLRDHFSSFGTITSAKVMVD-ENGRSKGFGFVCFEKP 393



 Score = 37.1 bits (82), Expect = 0.009
 Identities = 29/120 (24%), Positives = 50/120 (41%), Gaps = 4/120 (3%)
 Frame = +2

Query: 86  GKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQ 265
           G +F+  L      +++   FS +G ++ C V  + E G S+G+GFV F         ++
Sbjct: 145 GNIFIKNLDRVIDNKSVYDTFSLFGNILSCKVATDDE-GNSKGYGFVHFETEHSAQTAIE 203

Query: 266 --NGPHQLDGRTIDPK--PCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIFRTLWE 433
             NG    D +    K  P   R  +  + G  Y  VF+     ++ +  L  +F    E
Sbjct: 204 KVNGMLLSDKKVYVGKFQPRAQRMKELGESGLKYTNVFVKNFGEHLDQEKLSAMFSKFGE 263


>Z50110-1|CAA90444.1|  692|Caenorhabditis elegans Hypothetical
           protein F18H3.3a protein.
          Length = 692

 Score = 45.6 bits (103), Expect = 3e-05
 Identities = 21/49 (42%), Positives = 30/49 (61%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           +FV        QE L   FS++GE+   VVM +++ G+ +GFGFV FAD
Sbjct: 240 VFVKNFGEHLDQEKLSAMFSKFGEITSAVVMTDAQ-GKPKGFGFVAFAD 287



 Score = 41.1 bits (92), Expect = 6e-04
 Identities = 19/50 (38%), Positives = 31/50 (62%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADP 241
           L+V  +  + + + L+ +FS +G +    VM + E+GRS+GFGFV F  P
Sbjct: 345 LYVKNIEEDLNDDGLRDHFSSFGTITSAKVMVD-ENGRSKGFGFVCFEKP 393



 Score = 37.1 bits (82), Expect = 0.009
 Identities = 29/120 (24%), Positives = 50/120 (41%), Gaps = 4/120 (3%)
 Frame = +2

Query: 86  GKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQ 265
           G +F+  L      +++   FS +G ++ C V  + E G S+G+GFV F         ++
Sbjct: 145 GNIFIKNLDRVIDNKSVYDTFSLFGNILSCKVATDDE-GNSKGYGFVHFETEHSAQTAIE 203

Query: 266 --NGPHQLDGRTIDPK--PCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIFRTLWE 433
             NG    D +    K  P   R  +  + G  Y  VF+     ++ +  L  +F    E
Sbjct: 204 KVNGMLLSDKKVYVGKFQPRAQRMKELGESGLKYTNVFVKNFGEHLDQEKLSAMFSKFGE 263


>U39997-3|AAK68389.1|  498|Caenorhabditis elegans Human daz (deleted
           in azoospermia)homolog protein 1 protein.
          Length = 498

 Score = 45.6 bits (103), Expect = 3e-05
 Identities = 23/69 (33%), Positives = 39/69 (56%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           ++FVGG    T++  L+ +F ++  V D V M  S  G+S+G+GF+TF        + + 
Sbjct: 67  RIFVGGFPTSTTETELREHFEKFFAVKD-VKMVKSLDGQSKGYGFITFETEDQAEEIRKL 125

Query: 269 GPHQLDGRT 295
            P QL+ R+
Sbjct: 126 TPKQLEFRS 134



 Score = 28.7 bits (61), Expect = 3.2
 Identities = 10/20 (50%), Positives = 16/20 (80%)
 Frame = +2

Query: 359 KVFLGGLPSNVTETDLRXIF 418
           ++F+GG P++ TET+LR  F
Sbjct: 67  RIFVGGFPTSTTETELREHF 86


>AB025253-1|BAA88577.1|  499|Caenorhabditis elegans DAZ-1 protein.
          Length = 499

 Score = 45.6 bits (103), Expect = 3e-05
 Identities = 23/69 (33%), Positives = 39/69 (56%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           ++FVGG    T++  L+ +F ++  V D V M  S  G+S+G+GF+TF        + + 
Sbjct: 68  RIFVGGFPTSTTETELREHFEKFFAVKD-VKMVKSLDGQSKGYGFITFETEDQAEEIRKL 126

Query: 269 GPHQLDGRT 295
            P QL+ R+
Sbjct: 127 TPKQLEFRS 135



 Score = 28.7 bits (61), Expect = 3.2
 Identities = 10/20 (50%), Positives = 16/20 (80%)
 Frame = +2

Query: 359 KVFLGGLPSNVTETDLRXIF 418
           ++F+GG P++ TET+LR  F
Sbjct: 68  RIFVGGFPTSTTETELREHF 87


>U23484-3|AAK68298.1|  126|Caenorhabditis elegans Sr protein
           (splicing factor) protein4, isoform b protein.
          Length = 126

 Score = 44.8 bits (101), Expect = 5e-05
 Identities = 24/70 (34%), Positives = 40/70 (57%), Gaps = 1/70 (1%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           L +  LS++T+  +L+R F RYG++ D  + ++  S +S+GFGFV F +       L   
Sbjct: 21  LKIDNLSYQTTPNDLRRTFERYGDIGDVHIPRDKYSRQSKGFGFVRFYERRDAEHALDRT 80

Query: 272 PHQL-DGRTI 298
             +L DGR +
Sbjct: 81  DGKLVDGREL 90



 Score = 27.9 bits (59), Expect = 5.7
 Identities = 12/29 (41%), Positives = 18/29 (62%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSF 503
           F RYG + +V I  D+  ++S G GF+ F
Sbjct: 39  FERYGDIGDVHIPRDKYSRQSKGFGFVRF 67


>U23484-2|AAC46767.1|  196|Caenorhabditis elegans Sr protein
           (splicing factor) protein4, isoform a protein.
          Length = 196

 Score = 44.8 bits (101), Expect = 5e-05
 Identities = 24/70 (34%), Positives = 40/70 (57%), Gaps = 1/70 (1%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           L +  LS++T+  +L+R F RYG++ D  + ++  S +S+GFGFV F +       L   
Sbjct: 21  LKIDNLSYQTTPNDLRRTFERYGDIGDVHIPRDKYSRQSKGFGFVRFYERRDAEHALDRT 80

Query: 272 PHQL-DGRTI 298
             +L DGR +
Sbjct: 81  DGKLVDGREL 90



 Score = 27.9 bits (59), Expect = 5.7
 Identities = 12/29 (41%), Positives = 18/29 (62%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSF 503
           F RYG + +V I  D+  ++S G GF+ F
Sbjct: 39  FERYGDIGDVHIPRDKYSRQSKGFGFVRF 67


>Z81108-4|CAB03237.1|   85|Caenorhabditis elegans Hypothetical
           protein R09B3.3 protein.
          Length = 85

 Score = 44.4 bits (100), Expect = 6e-05
 Identities = 18/49 (36%), Positives = 33/49 (67%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           ++VG   ++T++++L  YFS+ G V +  ++ + E+GR RGF FV F +
Sbjct: 6   VYVGNAPFQTTEDDLGNYFSQAGNVSNVRIVCDRETGRPRGFAFVEFTE 54


>U24123-1|AAA65224.1|  646|Caenorhabditis elegans
           polyadenylate-binding protein protein.
          Length = 646

 Score = 43.6 bits (98), Expect = 1e-04
 Identities = 18/48 (37%), Positives = 31/48 (64%)
 Frame = +2

Query: 122 SQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQ 265
           ++E L++ F+++G +  C VM  +  G+S+GFGFV FA+P      +Q
Sbjct: 225 NKETLEKVFAKFGNITSCEVM--TVEGKSKGFGFVAFANPEEAETAVQ 270



 Score = 41.9 bits (94), Expect = 3e-04
 Identities = 20/50 (40%), Positives = 28/50 (56%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADP 241
           L+V  L      + L++ F  YG +    VM + E+GRS+GFGFV F  P
Sbjct: 319 LYVKNLDETVDDDGLKKQFESYGNITSAKVMTD-ENGRSKGFGFVCFEKP 367



 Score = 37.1 bits (82), Expect = 0.009
 Identities = 34/152 (22%), Positives = 63/152 (41%), Gaps = 4/152 (2%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF-A 235
           +P M     G +F+  L      +++   FS +G ++ C V  + E G S+G+GFV F  
Sbjct: 111 DPAMRRSGAGNIFIKNLDKVIDNKSIYDTFSLFGNILSCKVAID-EDGFSKGYGFVHFET 169

Query: 236 DPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRG---GGYPKVFLGGLPSNVTETDL 406
           + +  N + +     L G+ +      PR  +  + G     +  V++     +  +  L
Sbjct: 170 EEAAQNAIQKVNGMLLAGKKVFVGKFQPRAQRNRELGETAKQFTNVYVKNFGDHYNKETL 229

Query: 407 RXIFRTLWEGHGGGHYV*SXEEKVXGFXILVF 502
             +F     G+     V + E K  GF  + F
Sbjct: 230 EKVFAKF--GNITSCEVMTVEGKSKGFGFVAF 259


>AL032631-4|CAE54917.1|  586|Caenorhabditis elegans Hypothetical
           protein Y106G6H.2c protein.
          Length = 586

 Score = 43.6 bits (98), Expect = 1e-04
 Identities = 18/48 (37%), Positives = 31/48 (64%)
 Frame = +2

Query: 122 SQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQ 265
           ++E L++ F+++G +  C VM  +  G+S+GFGFV FA+P      +Q
Sbjct: 165 NKETLEKLFAKFGNITSCEVM--TVEGKSKGFGFVAFANPEEAETAVQ 210



 Score = 41.9 bits (94), Expect = 3e-04
 Identities = 20/50 (40%), Positives = 28/50 (56%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADP 241
           L+V  L      + L++ F  YG +    VM + E+GRS+GFGFV F  P
Sbjct: 259 LYVKNLDETVDDDGLKKQFESYGNITSAKVMTD-ENGRSKGFGFVCFEKP 307


>AL032631-3|CAE54916.1|  583|Caenorhabditis elegans Hypothetical
           protein Y106G6H.2b protein.
          Length = 583

 Score = 43.6 bits (98), Expect = 1e-04
 Identities = 18/48 (37%), Positives = 31/48 (64%)
 Frame = +2

Query: 122 SQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQ 265
           ++E L++ F+++G +  C VM  +  G+S+GFGFV FA+P      +Q
Sbjct: 162 NKETLEKLFAKFGNITSCEVM--TVEGKSKGFGFVAFANPEEAETAVQ 207



 Score = 41.9 bits (94), Expect = 3e-04
 Identities = 20/50 (40%), Positives = 28/50 (56%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADP 241
           L+V  L      + L++ F  YG +    VM + E+GRS+GFGFV F  P
Sbjct: 256 LYVKNLDETVDDDGLKKQFESYGNITSAKVMTD-ENGRSKGFGFVCFEKP 304



 Score = 36.7 bits (81), Expect = 0.012
 Identities = 34/152 (22%), Positives = 63/152 (41%), Gaps = 4/152 (2%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF-A 235
           +P M     G +F+  L      +++   FS +G ++ C V  + E G S+G+GFV F  
Sbjct: 48  DPAMRRSGAGNIFIKNLDKVIDNKSIYDTFSLFGNILSCKVAID-EDGFSKGYGFVHFET 106

Query: 236 DPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRG---GGYPKVFLGGLPSNVTETDL 406
           + +  N + +     L G+ +      PR  +  + G     +  V++     +  +  L
Sbjct: 107 EEAAQNAIQKVNGMLLAGKKVFVGKFQPRAQRNRELGETAKQFTNVYVKNFGDHYNKETL 166

Query: 407 RXIFRTLWEGHGGGHYV*SXEEKVXGFXILVF 502
             +F     G+     V + E K  GF  + F
Sbjct: 167 EKLFAKF--GNITSCEVMTVEGKSKGFGFVAF 196


>AL032631-2|CAA21572.1|  646|Caenorhabditis elegans Hypothetical
           protein Y106G6H.2a protein.
          Length = 646

 Score = 43.6 bits (98), Expect = 1e-04
 Identities = 18/48 (37%), Positives = 31/48 (64%)
 Frame = +2

Query: 122 SQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQ 265
           ++E L++ F+++G +  C VM  +  G+S+GFGFV FA+P      +Q
Sbjct: 225 NKETLEKLFAKFGNITSCEVM--TVEGKSKGFGFVAFANPEEAETAVQ 270



 Score = 41.9 bits (94), Expect = 3e-04
 Identities = 20/50 (40%), Positives = 28/50 (56%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADP 241
           L+V  L      + L++ F  YG +    VM + E+GRS+GFGFV F  P
Sbjct: 319 LYVKNLDETVDDDGLKKQFESYGNITSAKVMTD-ENGRSKGFGFVCFEKP 367



 Score = 36.7 bits (81), Expect = 0.012
 Identities = 34/152 (22%), Positives = 63/152 (41%), Gaps = 4/152 (2%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF-A 235
           +P M     G +F+  L      +++   FS +G ++ C V  + E G S+G+GFV F  
Sbjct: 111 DPAMRRSGAGNIFIKNLDKVIDNKSIYDTFSLFGNILSCKVAID-EDGFSKGYGFVHFET 169

Query: 236 DPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRG---GGYPKVFLGGLPSNVTETDL 406
           + +  N + +     L G+ +      PR  +  + G     +  V++     +  +  L
Sbjct: 170 EEAAQNAIQKVNGMLLAGKKVFVGKFQPRAQRNRELGETAKQFTNVYVKNFGDHYNKETL 229

Query: 407 RXIFRTLWEGHGGGHYV*SXEEKVXGFXILVF 502
             +F     G+     V + E K  GF  + F
Sbjct: 230 EKLFAKF--GNITSCEVMTVEGKSKGFGFVAF 259


>U28944-7|AAN63457.1|  295|Caenorhabditis elegans Hypothetical
           protein C18A3.5f protein.
          Length = 295

 Score = 43.2 bits (97), Expect = 1e-04
 Identities = 17/47 (36%), Positives = 32/47 (68%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           +FVG LS E   + L+  F  +G+V D  V++++ + +S+G+GFV++
Sbjct: 24  VFVGDLSSEVDNQKLREAFQPFGDVSDAKVIRDTNTTKSKGYGFVSY 70


>U28944-6|AAN63456.1|  305|Caenorhabditis elegans Hypothetical
           protein C18A3.5e protein.
          Length = 305

 Score = 43.2 bits (97), Expect = 1e-04
 Identities = 17/47 (36%), Positives = 32/47 (68%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           +FVG LS E   + L+  F  +G+V D  V++++ + +S+G+GFV++
Sbjct: 34  VFVGDLSSEVDNQKLREAFQPFGDVSDAKVIRDTNTTKSKGYGFVSY 80


>U28944-5|AAK68191.1|  408|Caenorhabditis elegans Hypothetical
           protein C18A3.5a protein.
          Length = 408

 Score = 43.2 bits (97), Expect = 1e-04
 Identities = 17/47 (36%), Positives = 32/47 (68%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           +FVG LS E   + L+  F  +G+V D  V++++ + +S+G+GFV++
Sbjct: 137 VFVGDLSSEVDNQKLREAFQPFGDVSDAKVIRDTNTTKSKGYGFVSY 183


>U28944-4|AAK68192.1|  376|Caenorhabditis elegans Hypothetical
           protein C18A3.5b protein.
          Length = 376

 Score = 43.2 bits (97), Expect = 1e-04
 Identities = 17/47 (36%), Positives = 32/47 (68%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           +FVG LS E   + L+  F  +G+V D  V++++ + +S+G+GFV++
Sbjct: 105 VFVGDLSSEVDNQKLREAFQPFGDVSDAKVIRDTNTTKSKGYGFVSY 151


>Z92826-4|CAB07322.1|  309|Caenorhabditis elegans Hypothetical
           protein C18D11.4 protein.
          Length = 309

 Score = 42.3 bits (95), Expect = 2e-04
 Identities = 22/63 (34%), Positives = 36/63 (57%), Gaps = 1/63 (1%)
 Frame = +2

Query: 47  GMRMNPDMDDDEKGK-LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGF 223
           G     D ++ +  K L V  LS  T++++L+  F  +GE+  C ++ +  SG SRGFGF
Sbjct: 62  GRNQQYDRENPQPSKCLGVFNLSSYTTEKDLRDVFGEFGEINKCDLVYDRPSGNSRGFGF 121

Query: 224 VTF 232
           + F
Sbjct: 122 IYF 124



 Score = 28.3 bits (60), Expect = 4.3
 Identities = 10/29 (34%), Positives = 18/29 (62%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSF 503
           FG +G++ +  ++YD+    S G GF+ F
Sbjct: 96  FGEFGEINKCDLVYDRPSGNSRGFGFIYF 124


>AC024818-2|AAF60781.1|  302|Caenorhabditis elegans Temporarily
           assigned gene nameprotein 262 protein.
          Length = 302

 Score = 41.9 bits (94), Expect = 3e-04
 Identities = 24/83 (28%), Positives = 42/83 (50%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           D+   ++F G L  E S E L + F +Y       V++ S + +S+G+GFV+F D    +
Sbjct: 199 DENDFRVFCGDLGNEVSDELLAKAFRKYPSFQKAKVVRESRTNKSKGYGFVSFRDSE--D 256

Query: 254 LVLQNGPHQLDGRTIDPKPCNPR 322
            V      ++DG+ +  +P   R
Sbjct: 257 YV--RAMREMDGKYVGNRPIKLR 277


>Z81106-3|CAB03222.1|   84|Caenorhabditis elegans Hypothetical
           protein R06C1.4 protein.
          Length = 84

 Score = 41.5 bits (93), Expect = 4e-04
 Identities = 16/49 (32%), Positives = 32/49 (65%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           ++VG + ++ ++E +  YF+  G V +  ++ + E+GR RGF FV F++
Sbjct: 8   VYVGNVPYQGTEEEIGNYFAAVGHVNNVRIVYDRETGRPRGFAFVEFSE 56


>Z68297-5|CAC70081.1|  394|Caenorhabditis elegans Hypothetical
           protein F11A10.7 protein.
          Length = 394

 Score = 41.5 bits (93), Expect = 4e-04
 Identities = 21/70 (30%), Positives = 41/70 (58%), Gaps = 1/70 (1%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFS-RYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           +FVG L +E +++ L  +FS + G V    ++++ ++G+ +GF FV F   S V+L L  
Sbjct: 248 IFVGNLPFEITEDALITFFSAQIGPVEAVRIVRDKDTGKGKGFAFVNFKQDSSVSLALSM 307

Query: 269 GPHQLDGRTI 298
              +++ R +
Sbjct: 308 ETIKMEKRDL 317


>Z83119-2|CAB05579.2|  608|Caenorhabditis elegans Hypothetical
           protein R05H10.2 protein.
          Length = 608

 Score = 41.1 bits (92), Expect = 6e-04
 Identities = 18/54 (33%), Positives = 35/54 (64%), Gaps = 1/54 (1%)
 Frame = +2

Query: 83  KGKL-FVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADP 241
           +GK+ F+  LS++T +E ++   S++G++   ++ K  +SG S+G  FV F+ P
Sbjct: 261 EGKVVFLRNLSYDTKEELIKEELSKFGKIDLAIICKYKDSGHSKGTAFVHFSTP 314


>Z46676-8|CAB60993.2|  388|Caenorhabditis elegans Hypothetical
           protein C08B11.5 protein.
          Length = 388

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 19/54 (35%), Positives = 31/54 (57%), Gaps = 1/54 (1%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCV-VMKNSESGRSRGFGFVTFA 235
           D    +FVG L  E  ++ L   FS +G ++    +M++ +SG S+GF F+ FA
Sbjct: 97  DVGANIFVGNLDPEVDEKLLYDTFSAFGVILQVPKIMRDVDSGTSKGFAFINFA 150



 Score = 35.1 bits (77), Expect = 0.037
 Identities = 17/61 (27%), Positives = 31/61 (50%)
 Frame = +2

Query: 50  MRMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVT 229
           M   P ++ ++   ++VGGL  + S+  L     + G V+   + K+  +   +GFGFV 
Sbjct: 1   MSAGPIVERNQDATIYVGGLDEKVSESILWELMVQAGPVVSVNMPKDRVTANHQGFGFVE 60

Query: 230 F 232
           F
Sbjct: 61  F 61


>U24189-3|AAC47514.1|  398|Caenorhabditis elegans RRM-type RNA
           binding protein protein.
          Length = 398

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 19/54 (35%), Positives = 31/54 (57%), Gaps = 1/54 (1%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCV-VMKNSESGRSRGFGFVTFA 235
           D    +FVG L  E  ++ L   FS +G ++    +M++ +SG S+GF F+ FA
Sbjct: 107 DVGANIFVGNLDPEVDEKLLYDTFSAFGVILQVPKIMRDVDSGTSKGFAFINFA 160



 Score = 35.1 bits (77), Expect = 0.037
 Identities = 17/61 (27%), Positives = 31/61 (50%)
 Frame = +2

Query: 50  MRMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVT 229
           M   P ++ ++   ++VGGL  + S+  L     + G V+   + K+  +   +GFGFV 
Sbjct: 11  MSAGPIVERNQDATIYVGGLDEKVSESILWELMVQAGPVVSVNMPKDRVTANHQGFGFVE 70

Query: 230 F 232
           F
Sbjct: 71  F 71


>Z66521-4|CAD59160.1|  150|Caenorhabditis elegans Hypothetical
           protein W02B12.3c protein.
          Length = 150

 Score = 39.1 bits (87), Expect = 0.002
 Identities = 28/96 (29%), Positives = 50/96 (52%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           ++++G L+   S+++++ +F  YG++ D V++KN       GFGFV F D        ++
Sbjct: 4   RIYIGRLTSRVSEKDIEHFFRGYGQIRD-VLLKN-------GFGFVEFDD----KRDAED 51

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGG 376
             H L+G+ +  +        KP+ GGG    F GG
Sbjct: 52  AVHDLNGKELGGERV-ILDYSKPRGGGGDRGGFGGG 86


>Z66521-3|CAD59159.1|  148|Caenorhabditis elegans Hypothetical
           protein W02B12.3b protein.
          Length = 148

 Score = 39.1 bits (87), Expect = 0.002
 Identities = 28/96 (29%), Positives = 50/96 (52%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           ++++G L+   S+++++ +F  YG++ D V++KN       GFGFV F D        ++
Sbjct: 4   RIYIGRLTSRVSEKDIEHFFRGYGQIRD-VLLKN-------GFGFVEFDD----KRDAED 51

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGG 376
             H L+G+ +  +        KP+ GGG    F GG
Sbjct: 52  AVHDLNGKELGGERV-ILDYSKPRGGGGDRGGFGGG 86


>Z66521-2|CAA91395.1|  312|Caenorhabditis elegans Hypothetical
           protein W02B12.3a protein.
          Length = 312

 Score = 39.1 bits (87), Expect = 0.002
 Identities = 28/96 (29%), Positives = 50/96 (52%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           ++++G L+   S+++++ +F  YG++ D V++KN       GFGFV F D        ++
Sbjct: 4   RIYIGRLTSRVSEKDIEHFFRGYGQIRD-VLLKN-------GFGFVEFDD----KRDAED 51

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGG 376
             H L+G+ +  +        KP+ GGG    F GG
Sbjct: 52  AVHDLNGKELGGERV-ILDYSKPRGGGGDRGGFGGG 86


>Z97628-2|CAB10726.2|  427|Caenorhabditis elegans Hypothetical
           protein F39H2.2a protein.
          Length = 427

 Score = 38.7 bits (86), Expect = 0.003
 Identities = 17/47 (36%), Positives = 31/47 (65%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           LFV  L+  T+ E+L+  FSR+G++ +C ++++  SG S  + F+ F
Sbjct: 243 LFVCKLNPVTTDEDLEIIFSRFGKINNCEIVRDRRSGDSLQYAFIEF 289


>Z81080-5|CAB03088.2|  427|Caenorhabditis elegans Hypothetical
           protein F39H2.2a protein.
          Length = 427

 Score = 38.7 bits (86), Expect = 0.003
 Identities = 17/47 (36%), Positives = 31/47 (65%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           LFV  L+  T+ E+L+  FSR+G++ +C ++++  SG S  + F+ F
Sbjct: 243 LFVCKLNPVTTDEDLEIIFSRFGKINNCEIVRDRRSGDSLQYAFIEF 289


>Z81080-2|CAD56584.1|  358|Caenorhabditis elegans Hypothetical
           protein F39H2.2b protein.
          Length = 358

 Score = 38.7 bits (86), Expect = 0.003
 Identities = 17/47 (36%), Positives = 31/47 (65%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           LFV  L+  T+ E+L+  FSR+G++ +C ++++  SG S  + F+ F
Sbjct: 174 LFVCKLNPVTTDEDLEIIFSRFGKINNCEIVRDRRSGDSLQYAFIEF 220


>AL110485-8|CAB60356.1|  434|Caenorhabditis elegans Hypothetical
           protein Y46G5A.13 protein.
          Length = 434

 Score = 38.7 bits (86), Expect = 0.003
 Identities = 14/47 (29%), Positives = 30/47 (63%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           +FVG L  E     L+  F ++GEV +  +++++ + + +G+GFV++
Sbjct: 134 VFVGDLCSEIDSTKLREAFVKFGEVSEAKIIRDNNTNKGKGYGFVSY 180


>AC024826-10|AAM97977.1|  435|Caenorhabditis elegans Hypothetical
           protein Y55F3AM.3c protein.
          Length = 435

 Score = 38.3 bits (85), Expect = 0.004
 Identities = 21/73 (28%), Positives = 39/73 (53%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV 250
           ++ ++  L +  ++ +T   +L+ +FS  G V D  ++ +S +GRS+G  +V F D   V
Sbjct: 20  EERDQRTLLIMQIARDTRPRDLEEFFSAVGAVRDVRIITDSRTGRSKGICYVEFWDEESV 79

Query: 251 NLVLQNGPHQLDG 289
            L L     +L G
Sbjct: 80  PLGLALNGQRLMG 92


>AC024826-8|AAF60795.2|  580|Caenorhabditis elegans Hypothetical
           protein Y55F3AM.3a protein.
          Length = 580

 Score = 38.3 bits (85), Expect = 0.004
 Identities = 21/73 (28%), Positives = 39/73 (53%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV 250
           ++ ++  L +  ++ +T   +L+ +FS  G V D  ++ +S +GRS+G  +V F D   V
Sbjct: 165 EERDQRTLLIMQIARDTRPRDLEEFFSAVGAVRDVRIITDSRTGRSKGICYVEFWDEESV 224

Query: 251 NLVLQNGPHQLDG 289
            L L     +L G
Sbjct: 225 PLGLALNGQRLMG 237


>AF038623-4|AAO91699.1|  177|Caenorhabditis elegans Hypothetical
           protein T08B6.5 protein.
          Length = 177

 Score = 37.9 bits (84), Expect = 0.005
 Identities = 19/72 (26%), Positives = 36/72 (50%), Gaps = 3/72 (4%)
 Frame = +2

Query: 56  MNPDMDDDEKG---KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFV 226
           M P  ++ EK     ++VG + W+++   ++ +F+  G+V    + K+  +G  + F FV
Sbjct: 33  MAPTAEEQEKTDARSVYVGNVDWKSTVSEIEEHFAVCGKVARVTIPKDKFTGYQKNFAFV 92

Query: 227 TFADPSLVNLVL 262
            F     V L L
Sbjct: 93  EFQKLESVQLAL 104


>Z81473-3|CAB03896.4|  514|Caenorhabditis elegans Hypothetical
           protein C17D12.2 protein.
          Length = 514

 Score = 37.5 bits (83), Expect = 0.007
 Identities = 18/52 (34%), Positives = 35/52 (67%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           D+K KLF+G LS + S++ ++  F+ +GE+ +  V++ ++ G S+G  FV +
Sbjct: 122 DDK-KLFIGMLSKQQSEDEVRALFATFGELDEVTVLRGAD-GASKGCAFVKY 171



 Score = 27.1 bits (57), Expect = 9.9
 Identities = 10/20 (50%), Positives = 15/20 (75%)
 Frame = +2

Query: 359 KVFLGGLPSNVTETDLRXIF 418
           K+F+G +P N+ E DLR +F
Sbjct: 30  KLFVGQIPRNLEEKDLRHLF 49


>AY342388-1|AAQ19851.1|  514|Caenorhabditis elegans putative
           RNA-binding protein protein.
          Length = 514

 Score = 37.5 bits (83), Expect = 0.007
 Identities = 18/52 (34%), Positives = 35/52 (67%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           D+K KLF+G LS + S++ ++  F+ +GE+ +  V++ ++ G S+G  FV +
Sbjct: 122 DDK-KLFIGMLSKQQSEDEVRALFATFGELDEVTVLRGAD-GASKGCAFVKY 171



 Score = 27.1 bits (57), Expect = 9.9
 Identities = 10/20 (50%), Positives = 15/20 (75%)
 Frame = +2

Query: 359 KVFLGGLPSNVTETDLRXIF 418
           K+F+G +P N+ E DLR +F
Sbjct: 30  KLFVGQIPRNLEEKDLRHLF 49


>Z81037-3|CAB02750.1|  205|Caenorhabditis elegans Hypothetical
           protein C17E4.5 protein.
          Length = 205

 Score = 36.7 bits (81), Expect = 0.012
 Identities = 26/93 (27%), Positives = 42/93 (45%), Gaps = 6/93 (6%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           ++VG + +  + E ++++F   G V    +  +  SG  +GF +V F +   +   L   
Sbjct: 80  VYVGNVDYGATAEEIEQHFHGCGSVSRVTIQCDRFSGHPKGFAYVEFTEKEGMQNALAMT 139

Query: 272 PHQLDGRTI--DPKPCN----PRTLQKPKRGGG 352
              L GR I  DPK  N      T + P RG G
Sbjct: 140 DSLLRGRQIKVDPKRTNKPGMSTTNRPPFRGRG 172


>Z66521-8|CAA91394.1|  281|Caenorhabditis elegans Hypothetical
           protein W02B12.2 protein.
          Length = 281

 Score = 36.7 bits (81), Expect = 0.012
 Identities = 28/90 (31%), Positives = 46/90 (51%), Gaps = 1/90 (1%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           ++++G L    S  +++ +F  YG++ D V+MKN       GFGFV F D    +    +
Sbjct: 3   RVYIGRLPNRASDRDVEHFFRGYGKLSD-VIMKN-------GFGFVDFQDQRDAD----D 50

Query: 269 GPHQLDGRTIDPKPCNPRT-LQKPKRGGGY 355
             H L+G+ +    C  R  L+ P+R  GY
Sbjct: 51  AVHDLNGKEL----CGERVILEFPRRKVGY 76


>AL137227-1|CAB70238.2|  611|Caenorhabditis elegans Hypothetical
           protein F58D5.1 protein.
          Length = 611

 Score = 36.3 bits (80), Expect = 0.016
 Identities = 15/50 (30%), Positives = 30/50 (60%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           +++VG +  +  ++ L   F + G++ D  +M +  SG SRG+ FVT+ +
Sbjct: 201 EIYVGHIPTDVFEDTLVPLFEKSGKIWDLRLMMDPMSGASRGYAFVTYCN 250


>Z73102-13|CAA97405.1|  836|Caenorhabditis elegans Hypothetical
           protein B0035.12 protein.
          Length = 836

 Score = 35.1 bits (77), Expect = 0.037
 Identities = 25/91 (27%), Positives = 42/91 (46%), Gaps = 1/91 (1%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF-ADPSLVNL 256
           EK K+FV  + ++ + + L+  FS++G V   V     + G+ +G  FV F  + S    
Sbjct: 681 EKSKVFVRNVHFQATDDELKALFSKFGTVTS-VRRVTHKDGKPKGIAFVDFDTEASAQKC 739

Query: 257 VLQNGPHQLDGRTIDPKPCNPRTLQKPKRGG 349
           V       L  R ++    NP  ++K K  G
Sbjct: 740 VASGDKLMLRERELEVALSNP-PVKKDKSHG 769


>Z36238-3|CAA85276.1|  404|Caenorhabditis elegans Hypothetical
           protein R74.5a protein.
          Length = 404

 Score = 35.1 bits (77), Expect = 0.037
 Identities = 20/63 (31%), Positives = 32/63 (50%)
 Frame = +2

Query: 53  RMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           R       D   +L V  + ++  + +L   F + G V+D  ++ N E G S+GFGFVT 
Sbjct: 89  RSTSSSSTDGPRRLHVSNIPFKYREPDLTAMFEKVGPVVDVEIIFN-ERG-SKGFGFVTM 146

Query: 233 ADP 241
            +P
Sbjct: 147 QNP 149


>DQ485531-1|ABF22491.1|  404|Caenorhabditis elegans RNA-binding
           protein ASD-1 protein.
          Length = 404

 Score = 35.1 bits (77), Expect = 0.037
 Identities = 20/63 (31%), Positives = 32/63 (50%)
 Frame = +2

Query: 53  RMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           R       D   +L V  + ++  + +L   F + G V+D  ++ N E G S+GFGFVT 
Sbjct: 89  RSTSSSSTDGPRRLHVSNIPFKYREPDLTAMFEKVGPVVDVEIIFN-ERG-SKGFGFVTM 146

Query: 233 ADP 241
            +P
Sbjct: 147 QNP 149


>Z50874-3|CAA90773.1|  409|Caenorhabditis elegans Hypothetical
           protein R10E4.2b protein.
          Length = 409

 Score = 34.7 bits (76), Expect = 0.049
 Identities = 14/50 (28%), Positives = 26/50 (52%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADP 241
           L++ GL   T+ + L+   S+YG +     + +  +   +G+GFV F  P
Sbjct: 109 LYIRGLMPNTNDDLLREMCSKYGNIASTKAIMDKATNNCKGYGFVDFESP 158


>Z50874-2|CAA90772.1|  357|Caenorhabditis elegans Hypothetical
           protein R10E4.2a protein.
          Length = 357

 Score = 34.7 bits (76), Expect = 0.049
 Identities = 14/50 (28%), Positives = 26/50 (52%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADP 241
           L++ GL   T+ + L+   S+YG +     + +  +   +G+GFV F  P
Sbjct: 83  LYIRGLMPNTNDDLLREMCSKYGNIASTKAIMDKATNNCKGYGFVDFESP 132


>Z50044-2|CAA90354.1|  256|Caenorhabditis elegans Hypothetical
           protein F22B5.2 protein.
          Length = 256

 Score = 34.3 bits (75), Expect = 0.065
 Identities = 16/56 (28%), Positives = 29/56 (51%)
 Frame = +2

Query: 65  DMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           D +  ++    V  L  E +++ L+  F + G VI   + ++  +G  +GF FVTF
Sbjct: 169 DRNRSDENTCRVTNLPQEMNEDELRDLFGKIGRVIRIFIARDKVTGLPKGFAFVTF 224


>U79157-1|AAC26982.1|  496|Caenorhabditis elegans splicing factor
           U2AF65 protein.
          Length = 496

 Score = 33.9 bits (74), Expect = 0.086
 Identities = 14/59 (23%), Positives = 29/59 (49%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           D   K+F+GGL    +++ ++     +G  +    +     G S+G+ F  + DP+L +
Sbjct: 288 DSANKIFIGGLPNYLTEDQVKELLCSFGP-LKAFSLNVDSQGNSKGYAFAEYLDPTLTD 345


>U41531-7|AAA83161.2|  415|Caenorhabditis elegans Feminizing gene on
           x protein 1 protein.
          Length = 415

 Score = 33.9 bits (74), Expect = 0.086
 Identities = 28/94 (29%), Positives = 42/94 (44%), Gaps = 2/94 (2%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNL 256
           D   +L V  + +     +L+  F ++G V D  ++ N E G S+GFGFVT   P     
Sbjct: 150 DGPKRLHVSNIPFRFRDPDLKTMFEKFGVVSDVEIIFN-ERG-SKGFGFVTMERPQDAER 207

Query: 257 VLQN-GPHQLDGRTIDPKPCNPRT-LQKPKRGGG 352
             Q      ++GR I+      R   +K K  GG
Sbjct: 208 ARQELHGSMIEGRKIEVNCATARVHSKKVKPTGG 241


>U14946-1|AAA67723.1|  415|Caenorhabditis elegans ribonucleoprotein
           protein.
          Length = 415

 Score = 33.9 bits (74), Expect = 0.086
 Identities = 28/94 (29%), Positives = 42/94 (44%), Gaps = 2/94 (2%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNL 256
           D   +L V  + +     +L+  F ++G V D  ++ N E G S+GFGFVT   P     
Sbjct: 150 DGPKRLHVSNIPFRFRDPDLKTMFEKFGVVSDVEIIFN-ERG-SKGFGFVTMERPQDAER 207

Query: 257 VLQN-GPHQLDGRTIDPKPCNPRT-LQKPKRGGG 352
             Q      ++GR I+      R   +K K  GG
Sbjct: 208 ARQELHGSMIEGRKIEVNCATARVHSKKVKPTGG 241


>AC024875-3|AAK29989.1|  496|Caenorhabditis elegans U2af splicing
           factor protein 1,isoform a protein.
          Length = 496

 Score = 33.9 bits (74), Expect = 0.086
 Identities = 14/59 (23%), Positives = 29/59 (49%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           D   K+F+GGL    +++ ++     +G  +    +     G S+G+ F  + DP+L +
Sbjct: 288 DSANKIFIGGLPNYLTEDQVKELLCSFGP-LKAFSLNVDSQGNSKGYAFAEYLDPTLTD 345


>AC024875-2|AAM44400.1|  471|Caenorhabditis elegans U2af splicing
           factor protein 1,isoform d protein.
          Length = 471

 Score = 33.9 bits (74), Expect = 0.086
 Identities = 14/59 (23%), Positives = 29/59 (49%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           D   K+F+GGL    +++ ++     +G  +    +     G S+G+ F  + DP+L +
Sbjct: 263 DSANKIFIGGLPNYLTEDQVKELLCSFGP-LKAFSLNVDSQGNSKGYAFAEYLDPTLTD 320


>AC024875-1|AAL00879.1|  474|Caenorhabditis elegans U2af splicing
           factor protein 1,isoform c protein.
          Length = 474

 Score = 33.9 bits (74), Expect = 0.086
 Identities = 14/59 (23%), Positives = 29/59 (49%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           D   K+F+GGL    +++ ++     +G  +    +     G S+G+ F  + DP+L +
Sbjct: 266 DSANKIFIGGLPNYLTEDQVKELLCSFGP-LKAFSLNVDSQGNSKGYAFAEYLDPTLTD 323


>AL132904-14|CAC35847.2|  258|Caenorhabditis elegans Hypothetical
           protein Y111B2A.18 protein.
          Length = 258

 Score = 33.5 bits (73), Expect = 0.11
 Identities = 24/74 (32%), Positives = 36/74 (48%), Gaps = 1/74 (1%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD-PSLVNL 256
           E  K++VG L  +  ++ ++  F +YG  I  V +K   SGR   F FV F D     + 
Sbjct: 7   EDQKVYVGNLPGDVREKEVEDIFHKYGR-IKYVDIK---SGRGPAFAFVEFEDHRDAEDA 62

Query: 257 VLQNGPHQLDGRTI 298
           V     ++ DGR I
Sbjct: 63  VRARDGYEFDGRRI 76


>AF242767-1|AAG36874.1|  258|Caenorhabditis elegans SF2 protein.
          Length = 258

 Score = 33.5 bits (73), Expect = 0.11
 Identities = 24/74 (32%), Positives = 36/74 (48%), Gaps = 1/74 (1%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD-PSLVNL 256
           E  K++VG L  +  ++ ++  F +YG  I  V +K   SGR   F FV F D     + 
Sbjct: 7   EDQKVYVGNLPGDVREKEVEDIFHKYGR-IKYVDIK---SGRGPAFAFVEFEDHRDAEDA 62

Query: 257 VLQNGPHQLDGRTI 298
           V     ++ DGR I
Sbjct: 63  VRARDGYEFDGRRI 76


>U23484-7|ABB88232.1|  738|Caenorhabditis elegans Hypothetical
           protein EEED8.10a protein.
          Length = 738

 Score = 33.1 bits (72), Expect = 0.15
 Identities = 11/36 (30%), Positives = 23/36 (63%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSE 196
           K+ V  +S + +Q  LQ +FS+YG++  C++ +  +
Sbjct: 113 KIVVSNISAKVTQSQLQSFFSQYGKITSCILPREEK 148


>AC024791-23|AAM81102.1|  346|Caenorhabditis elegans Rnp (rrm rna
           binding domain) containingprotein 6, isoform c protein.
          Length = 346

 Score = 33.1 bits (72), Expect = 0.15
 Identities = 12/48 (25%), Positives = 27/48 (56%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           +++V  +  + S+ +L+  F  +GE++ C + +       RGFG++ F
Sbjct: 208 RVYVSSVHPDLSETDLKSVFEAFGEIVKCQLARAPTGRGHRGFGYLEF 255


>AC024791-22|AAF60676.1|  339|Caenorhabditis elegans Rnp (rrm rna
           binding domain) containingprotein 6, isoform a protein.
          Length = 339

 Score = 33.1 bits (72), Expect = 0.15
 Identities = 12/48 (25%), Positives = 27/48 (56%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           +++V  +  + S+ +L+  F  +GE++ C + +       RGFG++ F
Sbjct: 208 RVYVSSVHPDLSETDLKSVFEAFGEIVKCQLARAPTGRGHRGFGYLEF 255


>AC024791-21|AAF60666.1|  749|Caenorhabditis elegans Rnp (rrm rna
           binding domain) containingprotein 6, isoform b protein.
          Length = 749

 Score = 33.1 bits (72), Expect = 0.15
 Identities = 12/48 (25%), Positives = 27/48 (56%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           +++V  +  + S+ +L+  F  +GE++ C + +       RGFG++ F
Sbjct: 208 RVYVSSVHPDLSETDLKSVFEAFGEIVKCQLARAPTGRGHRGFGYLEF 255


>Z75552-9|CAA99945.2|  705|Caenorhabditis elegans Hypothetical
           protein W04D2.6a protein.
          Length = 705

 Score = 32.7 bits (71), Expect = 0.20
 Identities = 17/53 (32%), Positives = 29/53 (54%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           +   +FVG +S + S E +++  +  G V     +K S +G+ +GFGF  F D
Sbjct: 45  DSSPVFVGNISDKCSDEFIRKILNECGNVASWKRIKGS-NGKLQGFGFCHFTD 96


>Z75551-6|CAA99937.2|  705|Caenorhabditis elegans Hypothetical
           protein W04D2.6a protein.
          Length = 705

 Score = 32.7 bits (71), Expect = 0.20
 Identities = 17/53 (32%), Positives = 29/53 (54%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           +   +FVG +S + S E +++  +  G V     +K S +G+ +GFGF  F D
Sbjct: 45  DSSPVFVGNISDKCSDEFIRKILNECGNVASWKRIKGS-NGKLQGFGFCHFTD 96


>Z78419-2|CAB01702.1|  154|Caenorhabditis elegans Hypothetical
           protein F26A3.2 protein.
          Length = 154

 Score = 32.3 bits (70), Expect = 0.26
 Identities = 21/70 (30%), Positives = 33/70 (47%), Gaps = 1/70 (1%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN- 268
           L+VG LS+ T ++ +   F R G+V   ++  +       GF FV +       L LQN 
Sbjct: 39  LYVGNLSYYTKEDQVYELFGRAGDVRRVIMGLDRFKKTPCGFCFVEYYTREDAELALQNI 98

Query: 269 GPHQLDGRTI 298
              ++D R I
Sbjct: 99  SNTRMDDRVI 108


>U41007-9|AAL32213.1|  153|Caenorhabditis elegans Sr protein
           (splicing factor) protein6, isoform b protein.
          Length = 153

 Score = 31.9 bits (69), Expect = 0.35
 Identities = 28/107 (26%), Positives = 43/107 (40%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K++VGGL  + + + L+  F R+G +    V +     R  GF FV + D        ++
Sbjct: 4   KVYVGGLPSDATSQELEEIFDRFGRIRKVWVAR-----RPPGFAFVEYDDVR----DAED 54

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLR 409
               LDG  I             +RGGG      GG      ++ LR
Sbjct: 55  AVRALDGSRICGVRARVELSTGQRRGGGGRGGGFGGRGGGGRDSGLR 101



 Score = 28.3 bits (60), Expect = 4.3
 Identities = 11/20 (55%), Positives = 15/20 (75%)
 Frame = +2

Query: 359 KVFLGGLPSNVTETDLRXIF 418
           KV++GGLPS+ T  +L  IF
Sbjct: 4   KVYVGGLPSDATSQELEEIF 23


>Z81120-1|CAB03342.1|  207|Caenorhabditis elegans Hypothetical
           protein T12D8.2 protein.
          Length = 207

 Score = 31.1 bits (67), Expect = 0.61
 Identities = 26/98 (26%), Positives = 46/98 (46%), Gaps = 6/98 (6%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWE---TSQENLQRYFSRYGEVI---DCVVMKNSESGRSRGFGFVTFAD 238
           DE  K F+GGL ++   T  E + ++     E +   D  ++ + +SG  +GF +VTF +
Sbjct: 3   DEIFKAFIGGLPYDSIATDIETILKHCKFTDEELKKFDIHLVHDRDSGSFKGFAYVTFEN 62

Query: 239 PSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGG 352
              +N  + +G +  D      K    +   +  RGGG
Sbjct: 63  EQQMNTAI-SGLNGADFGNRVLKVNRAQQRDRSDRGGG 99


>U41007-10|AAL32214.1|  118|Caenorhabditis elegans Sr protein
           (splicing factor) protein6, isoform c protein.
          Length = 118

 Score = 31.1 bits (67), Expect = 0.61
 Identities = 24/88 (27%), Positives = 37/88 (42%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K++VGGL  + + + L+  F R+G +    V +     R  GF FV + D        ++
Sbjct: 4   KVYVGGLPSDATSQELEEIFDRFGRIRKVWVAR-----RPPGFAFVEYDDVR----DAED 54

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGGG 352
               LDG  I             +RGGG
Sbjct: 55  AVRALDGSRICGVRARVELSTGQRRGGG 82



 Score = 28.3 bits (60), Expect = 4.3
 Identities = 11/20 (55%), Positives = 15/20 (75%)
 Frame = +2

Query: 359 KVFLGGLPSNVTETDLRXIF 418
           KV++GGLPS+ T  +L  IF
Sbjct: 4   KVYVGGLPSDATSQELEEIF 23


>U41007-8|AAA82270.1|  179|Caenorhabditis elegans Sr protein
           (splicing factor) protein6, isoform a protein.
          Length = 179

 Score = 31.1 bits (67), Expect = 0.61
 Identities = 24/88 (27%), Positives = 37/88 (42%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K++VGGL  + + + L+  F R+G +    V +     R  GF FV + D        ++
Sbjct: 4   KVYVGGLPSDATSQELEEIFDRFGRIRKVWVAR-----RPPGFAFVEYDDVR----DAED 54

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGGG 352
               LDG  I             +RGGG
Sbjct: 55  AVRALDGSRICGVRARVELSTGQRRGGG 82



 Score = 28.3 bits (60), Expect = 4.3
 Identities = 11/20 (55%), Positives = 15/20 (75%)
 Frame = +2

Query: 359 KVFLGGLPSNVTETDLRXIF 418
           KV++GGLPS+ T  +L  IF
Sbjct: 4   KVYVGGLPSDATSQELEEIF 23


>Z78019-5|CAB01455.1|  305|Caenorhabditis elegans Hypothetical
           protein ZK863.7 protein.
          Length = 305

 Score = 29.9 bits (64), Expect = 1.4
 Identities = 18/83 (21%), Positives = 37/83 (44%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLFVG L        L++ F  + +V +C ++KN        + FV   +  +  ++ + 
Sbjct: 4   KLFVGNLPDNVDSNKLKQVFQPFCKVTECDIVKN--------YAFVHIEEDDVDPIITRL 55

Query: 269 GPHQLDGRTIDPKPCNPRTLQKP 337
             + +DG+ ++ K    +    P
Sbjct: 56  TGYTIDGKVVNIKKSTSKLRPTP 78


>U21302-2|AAA92287.1|  305|Caenorhabditis elegans RNP-1 protein.
          Length = 305

 Score = 29.9 bits (64), Expect = 1.4
 Identities = 18/83 (21%), Positives = 37/83 (44%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLFVG L        L++ F  + +V +C ++KN        + FV   +  +  ++ + 
Sbjct: 4   KLFVGNLPDNVDSNKLKQVFQPFCKVTECDIVKN--------YAFVHIEEDDVDPIITRL 55

Query: 269 GPHQLDGRTIDPKPCNPRTLQKP 337
             + +DG+ ++ K    +    P
Sbjct: 56  TGYTIDGKVVNIKKSTSKLRPTP 78


>Z36238-4|CAD82915.1|  286|Caenorhabditis elegans Hypothetical
           protein R74.5b protein.
          Length = 286

 Score = 29.5 bits (63), Expect = 1.9
 Identities = 15/32 (46%), Positives = 21/32 (65%)
 Frame = +2

Query: 146 FSRYGEVIDCVVMKNSESGRSRGFGFVTFADP 241
           F + G V+D  ++ N E G S+GFGFVT  +P
Sbjct: 2   FEKVGPVVDVEIIFN-ERG-SKGFGFVTMQNP 31


>AJ297847-1|CAC16732.1|  619|Caenorhabditis elegans FOG-1 protein
           protein.
          Length = 619

 Score = 28.7 bits (61), Expect = 3.2
 Identities = 15/50 (30%), Positives = 30/50 (60%), Gaps = 2/50 (4%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEV-IDC-VVMKNSESGRSRGFGFVTF 232
           K+FVGG+S   +++ + ++F ++G V +D  V  K +  G+S   G  ++
Sbjct: 206 KVFVGGISHMMNRKIINKFFGQFGTVFVDWPVKQKPNSRGKSIAIGSYSY 255


>AJ297846-1|CAC16731.1|  619|Caenorhabditis elegans FOG-1 protein
           protein.
          Length = 619

 Score = 28.7 bits (61), Expect = 3.2
 Identities = 15/50 (30%), Positives = 30/50 (60%), Gaps = 2/50 (4%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEV-IDC-VVMKNSESGRSRGFGFVTF 232
           K+FVGG+S   +++ + ++F ++G V +D  V  K +  G+S   G  ++
Sbjct: 206 KVFVGGISHMMNRKIINKFFGQFGTVFVDWPVKQKPNSRGKSIAIGSYSY 255


>AC024810-12|AAK68519.1|  619|Caenorhabditis elegans Feminization of
           germline protein1, isoform b protein.
          Length = 619

 Score = 28.7 bits (61), Expect = 3.2
 Identities = 15/50 (30%), Positives = 30/50 (60%), Gaps = 2/50 (4%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEV-IDC-VVMKNSESGRSRGFGFVTF 232
           K+FVGG+S   +++ + ++F ++G V +D  V  K +  G+S   G  ++
Sbjct: 206 KVFVGGISHMMNRKIINKFFGQFGTVFVDWPVKQKPNSRGKSIAIGSYSY 255


>Z81064-7|CAB02960.2|  382|Caenorhabditis elegans Hypothetical
           protein F16B12.8 protein.
          Length = 382

 Score = 28.3 bits (60), Expect = 4.3
 Identities = 12/43 (27%), Positives = 21/43 (48%)
 Frame = +3

Query: 249 STSCYRMDLINLMAGPSTLSRAILALFKNRNVAVDTLRCSLAG 377
           +T C+ +D++    G        + LF   +  +D +RCSL G
Sbjct: 211 NTKCHGVDILRAPDGADIYPDEAIKLFPTDSKILDRIRCSLIG 253


>U23450-1|AAK31467.2|  422|Caenorhabditis elegans Cpeb polya binding
           family protein 2 protein.
          Length = 422

 Score = 28.3 bits (60), Expect = 4.3
 Identities = 12/20 (60%), Positives = 15/20 (75%)
 Frame = +2

Query: 359 KVFLGGLPSNVTETDLRXIF 418
           KVF+GGLPS V E+D+   F
Sbjct: 89  KVFVGGLPSCVKESDILNFF 108



 Score = 27.9 bits (59), Expect = 5.7
 Identities = 11/26 (42%), Positives = 17/26 (65%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEV 166
           K+FVGGL     + ++  +FSRYG +
Sbjct: 89  KVFVGGLPSCVKESDILNFFSRYGRL 114


>AL031621-7|CAE46665.1|  382|Caenorhabditis elegans Hypothetical
           protein F16B12.8 protein.
          Length = 382

 Score = 28.3 bits (60), Expect = 4.3
 Identities = 12/43 (27%), Positives = 21/43 (48%)
 Frame = +3

Query: 249 STSCYRMDLINLMAGPSTLSRAILALFKNRNVAVDTLRCSLAG 377
           +T C+ +D++    G        + LF   +  +D +RCSL G
Sbjct: 211 NTKCHGVDILRAPDGADIYPDEAIKLFPTDSKILDRIRCSLIG 253


>U23172-15|AAN63408.1|  374|Caenorhabditis elegans Hypothetical
           protein F25B5.7d protein.
          Length = 374

 Score = 27.9 bits (59), Expect = 5.7
 Identities = 11/27 (40%), Positives = 19/27 (70%)
 Frame = +2

Query: 338 KRGGGYPKVFLGGLPSNVTETDLRXIF 418
           K+  G  ++F+G LP+ V ET+L+ +F
Sbjct: 110 KKFTGRCRLFVGNLPNEVKETELKELF 136


>U23172-14|AAL02495.1|  165|Caenorhabditis elegans Hypothetical
           protein F25B5.7b protein.
          Length = 165

 Score = 27.9 bits (59), Expect = 5.7
 Identities = 11/27 (40%), Positives = 19/27 (70%)
 Frame = +2

Query: 338 KRGGGYPKVFLGGLPSNVTETDLRXIF 418
           K+  G  ++F+G LP+ V ET+L+ +F
Sbjct: 110 KKFTGRCRLFVGNLPNEVKETELKELF 136


>U23172-12|ABH03526.1|  562|Caenorhabditis elegans Hypothetical
           protein F25B5.7a protein.
          Length = 562

 Score = 27.9 bits (59), Expect = 5.7
 Identities = 11/27 (40%), Positives = 19/27 (70%)
 Frame = +2

Query: 338 KRGGGYPKVFLGGLPSNVTETDLRXIF 418
           K+  G  ++F+G LP+ V ET+L+ +F
Sbjct: 110 KKFTGRCRLFVGNLPNEVKETELKELF 136


>Z81139-8|CAB03483.2|  361|Caenorhabditis elegans Hypothetical
           protein W05H5.7 protein.
          Length = 361

 Score = 27.5 bits (58), Expect = 7.5
 Identities = 9/20 (45%), Positives = 12/20 (60%)
 Frame = -1

Query: 578 FXSTCFPWRLMKCSWVTLST 519
           F + CF WRL+K +W    T
Sbjct: 313 FQNACFTWRLVKSAWTKPKT 332


>Z81062-15|CAB02950.2|  361|Caenorhabditis elegans Hypothetical
           protein W05H5.7 protein.
          Length = 361

 Score = 27.5 bits (58), Expect = 7.5
 Identities = 9/20 (45%), Positives = 12/20 (60%)
 Frame = -1

Query: 578 FXSTCFPWRLMKCSWVTLST 519
           F + CF WRL+K +W    T
Sbjct: 313 FQNACFTWRLVKSAWTKPKT 332


>AF003145-3|AAB57717.1|  751|Caenorhabditis elegans Cpeb polya
           binding family protein 3 protein.
          Length = 751

 Score = 27.5 bits (58), Expect = 7.5
 Identities = 13/41 (31%), Positives = 21/41 (51%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSR 211
           K+FVGG+ W+ ++  L+  F  +G    C V    +  R R
Sbjct: 296 KIFVGGVPWDITEAALKDSFGEFG---SCAVEWPGQEARYR 333


>Z82094-3|CAB05024.1| 2561|Caenorhabditis elegans Hypothetical protein
            T12D8.1 protein.
          Length = 2561

 Score = 27.1 bits (57), Expect = 9.9
 Identities = 16/41 (39%), Positives = 20/41 (48%)
 Frame = +2

Query: 263  QNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPS 385
            Q  P QL    +DP    P+T  K K+GGG PK      P+
Sbjct: 1448 QPPPVQLPQVDVDP----PKTAAKRKKGGGNPKKNASSYPA 1484


>Z81120-8|CAB03348.1| 2561|Caenorhabditis elegans Hypothetical protein
            T12D8.1 protein.
          Length = 2561

 Score = 27.1 bits (57), Expect = 9.9
 Identities = 16/41 (39%), Positives = 20/41 (48%)
 Frame = +2

Query: 263  QNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPS 385
            Q  P QL    +DP    P+T  K K+GGG PK      P+
Sbjct: 1448 QPPPVQLPQVDVDP----PKTAAKRKKGGGNPKKNASSYPA 1484


>Z19154-9|CAA79552.2|  559|Caenorhabditis elegans Hypothetical
           protein C40H1.1 protein.
          Length = 559

 Score = 27.1 bits (57), Expect = 9.9
 Identities = 10/27 (37%), Positives = 18/27 (66%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVI 169
           K+F+GGL  + S+E +   F  +G+V+
Sbjct: 246 KVFIGGLPIDVSEEQVWATFGAFGKVL 272


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,042,108
Number of Sequences: 27780
Number of extensions: 277708
Number of successful extensions: 920
Number of sequences better than 10.0: 110
Number of HSP's better than 10.0 without gapping: 764
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 891
length of database: 12,740,198
effective HSP length: 78
effective length of database: 10,573,358
effective search space used: 1237082886
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -