BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_F09 (450 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U00033-6|AAC48295.2| 104|Caenorhabditis elegans Ribosomal prote... 89 2e-18 AF125959-1|AAD14733.1| 475|Caenorhabditis elegans Hypothetical ... 27 8.3 >U00033-6|AAC48295.2| 104|Caenorhabditis elegans Ribosomal protein, large subunitprotein 36 protein. Length = 104 Score = 88.6 bits (210), Expect = 2e-18 Identities = 40/59 (67%), Positives = 49/59 (83%) Frame = +1 Query: 160 RDLVREVVGHAQYEKRAMELLKVSKDKRALKFLKRRLGTHIRAKRKREELSNVLAQMRK 336 R+LVRE+ G A YE+R +E+L++SKDKRALKFLKRR+GTH RAK KREEL NV+ RK Sbjct: 43 RELVREITGFAPYERRVLEMLRISKDKRALKFLKRRIGTHRRAKGKREELQNVIIAQRK 101 >AF125959-1|AAD14733.1| 475|Caenorhabditis elegans Hypothetical protein H23N18.4 protein. Length = 475 Score = 26.6 bits (56), Expect = 8.3 Identities = 10/21 (47%), Positives = 17/21 (80%) Frame = +1 Query: 166 LVREVVGHAQYEKRAMELLKV 228 +V+++V + +YEK A ELL+V Sbjct: 434 IVKDMVSNPKYEKNAQELLRV 454 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,946,626 Number of Sequences: 27780 Number of extensions: 141684 Number of successful extensions: 339 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 334 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 339 length of database: 12,740,198 effective HSP length: 75 effective length of database: 10,656,698 effective search space used: 788595652 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -