SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmov2p23
         (399 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z81545-5|CAB04440.1|  389|Caenorhabditis elegans Hypothetical pr...    79   9e-16
Z46267-2|CAC42301.1|  600|Caenorhabditis elegans Hypothetical pr...    79   9e-16
Z46267-1|CAC42302.1|  389|Caenorhabditis elegans Hypothetical pr...    79   9e-16
AF125461-4|AAK18995.1| 1360|Caenorhabditis elegans Hypothetical ...    29   0.93 
U40410-3|AAL27230.1| 1169|Caenorhabditis elegans Lin-12 and glp-...    27   3.7  
U40410-2|AAL27229.1| 1876|Caenorhabditis elegans Lin-12 and glp-...    27   3.7  
AC024876-12|AAF60896.2|  498|Caenorhabditis elegans Hypothetical...    27   3.7  
Z81573-2|CAB04626.1|  294|Caenorhabditis elegans Hypothetical pr...    26   8.7  

>Z81545-5|CAB04440.1|  389|Caenorhabditis elegans Hypothetical
           protein F49H6.5 protein.
          Length = 389

 Score = 79.4 bits (187), Expect = 9e-16
 Identities = 37/77 (48%), Positives = 43/77 (55%)
 Frame = +3

Query: 168 RVEAAASLSDLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGA 347
           R +      D+  R H YLRISLTE+CN RC YCMPAEG+P               +   
Sbjct: 58  RAKGQLPFFDMFMREHTYLRISLTEKCNFRCLYCMPAEGIPLKPKDKMLSNSEVLRLVKL 117

Query: 348 LAAAGVDKLRXTGGEPT 398
            AA GVDK+R TGGEPT
Sbjct: 118 FAAHGVDKVRLTGGEPT 134


>Z46267-2|CAC42301.1|  600|Caenorhabditis elegans Hypothetical
           protein F49E2.1b protein.
          Length = 600

 Score = 79.4 bits (187), Expect = 9e-16
 Identities = 37/68 (54%), Positives = 41/68 (60%)
 Frame = +3

Query: 195 DLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAGVDKL 374
           D+  R H YLRISLTE+CN RC YCMPAEGVP               +    AA GVDK+
Sbjct: 67  DMFMREHTYLRISLTEKCNFRCLYCMPAEGVPLKPKDKMLSNSEVLRLVKLFAAHGVDKV 126

Query: 375 RXTGGEPT 398
           R TGGEPT
Sbjct: 127 RLTGGEPT 134


>Z46267-1|CAC42302.1|  389|Caenorhabditis elegans Hypothetical
           protein F49E2.1a protein.
          Length = 389

 Score = 79.4 bits (187), Expect = 9e-16
 Identities = 37/68 (54%), Positives = 41/68 (60%)
 Frame = +3

Query: 195 DLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAGVDKL 374
           D+  R H YLRISLTE+CN RC YCMPAEGVP               +    AA GVDK+
Sbjct: 67  DMFMREHTYLRISLTEKCNFRCLYCMPAEGVPLKPKDKMLSNSEVLRLVKLFAAHGVDKV 126

Query: 375 RXTGGEPT 398
           R TGGEPT
Sbjct: 127 RLTGGEPT 134


>AF125461-4|AAK18995.1| 1360|Caenorhabditis elegans Hypothetical
           protein Y8A9A.2 protein.
          Length = 1360

 Score = 29.5 bits (63), Expect = 0.93
 Identities = 16/66 (24%), Positives = 21/66 (31%)
 Frame = +1

Query: 199 YMVVDTTTCEYLSLSDATCDASTACRRKACPCPVAARCCQWKSCG*XWARWRPPAWTSCG 378
           Y  +D+    Y +    T            P P    CC        W  W     T+CG
Sbjct: 619 YFPLDSCCAGYTATVSGTLHICGPQPTTTTPAPNDETCCPLDGIWGAWGEWSVCTGTTCG 678

Query: 379 SPXGSR 396
           +  GSR
Sbjct: 679 NCGGSR 684


>U40410-3|AAL27230.1| 1169|Caenorhabditis elegans Lin-12 and glp-1
           x-hybridizingprotein 1, isoform b protein.
          Length = 1169

 Score = 27.5 bits (58), Expect = 3.7
 Identities = 8/15 (53%), Positives = 10/15 (66%)
 Frame = +1

Query: 253 CDASTACRRKACPCP 297
           C  +T CR K+C CP
Sbjct: 738 CKGNTVCRNKSCQCP 752


>U40410-2|AAL27229.1| 1876|Caenorhabditis elegans Lin-12 and glp-1
           x-hybridizingprotein 1, isoform a protein.
          Length = 1876

 Score = 27.5 bits (58), Expect = 3.7
 Identities = 8/15 (53%), Positives = 10/15 (66%)
 Frame = +1

Query: 253 CDASTACRRKACPCP 297
           C  +T CR K+C CP
Sbjct: 835 CKGNTVCRNKSCQCP 849


>AC024876-12|AAF60896.2|  498|Caenorhabditis elegans Hypothetical
           protein Y94H6A.1 protein.
          Length = 498

 Score = 27.5 bits (58), Expect = 3.7
 Identities = 10/18 (55%), Positives = 11/18 (61%)
 Frame = -1

Query: 201 VGRLMRPPPPHGCHHCTI 148
           VGRL  PPPP    HC +
Sbjct: 55  VGRLKMPPPPPKLKHCEV 72


>Z81573-2|CAB04626.1|  294|Caenorhabditis elegans Hypothetical
           protein M02G9.3 protein.
          Length = 294

 Score = 26.2 bits (55), Expect = 8.7
 Identities = 11/37 (29%), Positives = 17/37 (45%), Gaps = 1/37 (2%)
 Frame = +1

Query: 223 CEYLSLSDA-TCDASTACRRKACPCPVAARCCQWKSC 330
           C  +++S   +C +  +    AC  P   R CQ  SC
Sbjct: 81  CTSITISSGPSCSSCQSACSSACTTPTCIRTCQRNSC 117


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 8,947,851
Number of Sequences: 27780
Number of extensions: 182501
Number of successful extensions: 523
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 487
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 510
length of database: 12,740,198
effective HSP length: 74
effective length of database: 10,684,478
effective search space used: 619699724
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -