BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0072 (417 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC006648-10|AAF39859.1| 305|Caenorhabditis elegans Btb and math... 30 0.78 Z30423-4|CAA83013.2| 1234|Caenorhabditis elegans Hypothetical pr... 28 3.1 L14433-1|AAA27979.1| 398|Caenorhabditis elegans Hypothetical pr... 28 3.1 U33058-1|AAB00542.1| 6632|Caenorhabditis elegans UNC-89 protein. 27 7.2 AF003131-5|AAV34799.1| 5992|Caenorhabditis elegans Uncoordinated... 27 7.2 AF003131-4|AAB54132.2| 6632|Caenorhabditis elegans Uncoordinated... 27 7.2 AF003131-3|AAV34801.1| 7122|Caenorhabditis elegans Uncoordinated... 27 7.2 AF003131-2|AAV34800.1| 7441|Caenorhabditis elegans Uncoordinated... 27 7.2 AF003131-1|AAP68958.1| 8081|Caenorhabditis elegans Uncoordinated... 27 7.2 Z54238-7|CAJ90498.1| 1861|Caenorhabditis elegans Hypothetical pr... 26 9.5 AC006632-1|AAK85466.1| 311|Caenorhabditis elegans Hypothetical ... 26 9.5 >AC006648-10|AAF39859.1| 305|Caenorhabditis elegans Btb and math domain containingprotein 5 protein. Length = 305 Score = 29.9 bits (64), Expect = 0.78 Identities = 18/54 (33%), Positives = 29/54 (53%), Gaps = 7/54 (12%) Frame = +1 Query: 274 TLGHYWKNGKEIEN-------TEDYVEEVYDASQYHGQDGLGAYAYGYQTPESA 414 TL H +KN ++E+ ED+ ++ S H ++ LG Y Y Y++ ESA Sbjct: 9 TLRHIFKNVSQLEDGKYLYSPDEDHFNVDWNMSISHKKEKLGVYFYCYKSEESA 62 >Z30423-4|CAA83013.2| 1234|Caenorhabditis elegans Hypothetical protein T20G5.5 protein. Length = 1234 Score = 27.9 bits (59), Expect = 3.1 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = +3 Query: 339 IRCVPIPRTRRSRCICLRIPNSRI 410 +RC+ R RRSR +C+ + R+ Sbjct: 104 VRCLKASRRRRSRRVCIEVEEDRV 127 >L14433-1|AAA27979.1| 398|Caenorhabditis elegans Hypothetical protein C50C3.7 protein. Length = 398 Score = 27.9 bits (59), Expect = 3.1 Identities = 18/66 (27%), Positives = 25/66 (37%) Frame = +1 Query: 205 GRTAVLPLIKYNDPRFRTVEAGPTLGHYWKNGKEIENTEDYVEEVYDASQYHGQDGLGAY 384 GR ++ IK D RF+ G GH G ++ Y D+ HG + G Sbjct: 88 GRKQLIGQIKRIDYRFQRNTMGGLTGHKGSIGVRLQLASPYSIVFVDSHFIHGPENYGKR 147 Query: 385 AYGYQT 402 Y T Sbjct: 148 VEQYHT 153 >U33058-1|AAB00542.1| 6632|Caenorhabditis elegans UNC-89 protein. Length = 6632 Score = 26.6 bits (56), Expect = 7.2 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +2 Query: 329 LKKYTMRPNTTDKTV*VHMPTDTKLPNLR 415 L KY +R +TTD+ V P + LP+ R Sbjct: 398 LDKYNIRQHTTDEDTIVLQPQEPGLPSFR 426 >AF003131-5|AAV34799.1| 5992|Caenorhabditis elegans Uncoordinated protein 89, isoform e protein. Length = 5992 Score = 26.6 bits (56), Expect = 7.2 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +2 Query: 329 LKKYTMRPNTTDKTV*VHMPTDTKLPNLR 415 L KY +R +TTD+ V P + LP+ R Sbjct: 398 LDKYNIRQHTTDEDTIVLQPQEPGLPSFR 426 >AF003131-4|AAB54132.2| 6632|Caenorhabditis elegans Uncoordinated protein 89, isoform a protein. Length = 6632 Score = 26.6 bits (56), Expect = 7.2 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +2 Query: 329 LKKYTMRPNTTDKTV*VHMPTDTKLPNLR 415 L KY +R +TTD+ V P + LP+ R Sbjct: 398 LDKYNIRQHTTDEDTIVLQPQEPGLPSFR 426 >AF003131-3|AAV34801.1| 7122|Caenorhabditis elegans Uncoordinated protein 89, isoform g protein. Length = 7122 Score = 26.6 bits (56), Expect = 7.2 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +2 Query: 329 LKKYTMRPNTTDKTV*VHMPTDTKLPNLR 415 L KY +R +TTD+ V P + LP+ R Sbjct: 398 LDKYNIRQHTTDEDTIVLQPQEPGLPSFR 426 >AF003131-2|AAV34800.1| 7441|Caenorhabditis elegans Uncoordinated protein 89, isoform f protein. Length = 7441 Score = 26.6 bits (56), Expect = 7.2 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +2 Query: 329 LKKYTMRPNTTDKTV*VHMPTDTKLPNLR 415 L KY +R +TTD+ V P + LP+ R Sbjct: 398 LDKYNIRQHTTDEDTIVLQPQEPGLPSFR 426 >AF003131-1|AAP68958.1| 8081|Caenorhabditis elegans Uncoordinated protein 89, isoform b protein. Length = 8081 Score = 26.6 bits (56), Expect = 7.2 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +2 Query: 329 LKKYTMRPNTTDKTV*VHMPTDTKLPNLR 415 L KY +R +TTD+ V P + LP+ R Sbjct: 398 LDKYNIRQHTTDEDTIVLQPQEPGLPSFR 426 >Z54238-7|CAJ90498.1| 1861|Caenorhabditis elegans Hypothetical protein T28C6.9 protein. Length = 1861 Score = 26.2 bits (55), Expect = 9.5 Identities = 18/62 (29%), Positives = 29/62 (46%) Frame = +3 Query: 117 RHRRLPN*HRARRSTEVLKQPTIHRSSISWPHRCLTIDQIQRPEVSHS*SRPHSWTLLEE 296 R L N R++T+VL+ P+I + + P + T Q E SH S + E+ Sbjct: 283 RELELKNGPVQRKTTQVLEPPSIEQIQMVQPVQMTTSAAPQASESSHQYEMTTSTSSSEK 342 Query: 297 RK 302 R+ Sbjct: 343 RR 344 >AC006632-1|AAK85466.1| 311|Caenorhabditis elegans Hypothetical protein F28A10.1 protein. Length = 311 Score = 26.2 bits (55), Expect = 9.5 Identities = 13/45 (28%), Positives = 21/45 (46%), Gaps = 2/45 (4%) Frame = -1 Query: 186 EWWAV*VLLCFFGLDVNLEDVDAGFRRRRHNCDHGEN--RHIRSM 58 E W V F + + ED F ++ CDH N +H+R++ Sbjct: 45 EEWNSCVAQKFLAIPMTAEDFWGSFEKKSRACDHDTNVTQHLRAI 89 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,839,643 Number of Sequences: 27780 Number of extensions: 198581 Number of successful extensions: 579 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 555 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 579 length of database: 12,740,198 effective HSP length: 74 effective length of database: 10,684,478 effective search space used: 683806592 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -