SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120043.Seq
         (810 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY350451-1|AAQ54691.1|  332|Caenorhabditis elegans calcium/calmo...    49   3e-06
AF099924-1|AAF23187.1|  348|Caenorhabditis elegans Cam kinase pr...    49   3e-06
AB021864-1|BAA82674.1|  348|Caenorhabditis elegans Ca2+/calmodul...    49   3e-06
Z83228-3|CAB60998.1|  536|Caenorhabditis elegans Hypothetical pr...    48   8e-06
AF145377-1|AAD39816.1|  536|Caenorhabditis elegans MOM-4 protein.      48   8e-06
AF143242-1|AAD37359.1|  536|Caenorhabditis elegans protein kinas...    48   8e-06
Z96102-6|CAJ85756.1| 1062|Caenorhabditis elegans Hypothetical pr...    46   2e-05
Z96102-5|CAB54262.2| 1096|Caenorhabditis elegans Hypothetical pr...    46   2e-05
Z96102-4|CAB54263.1| 1192|Caenorhabditis elegans Hypothetical pr...    46   2e-05
Z81027-7|CAJ85745.1| 1062|Caenorhabditis elegans Hypothetical pr...    46   2e-05
Z81027-6|CAB54178.2| 1096|Caenorhabditis elegans Hypothetical pr...    46   2e-05
Z81027-5|CAB54179.1| 1192|Caenorhabditis elegans Hypothetical pr...    46   2e-05
Z74031-18|CAA98453.3|  333|Caenorhabditis elegans Hypothetical p...    46   2e-05
U97196-3|AAB52459.2|  305|Caenorhabditis elegans Aurora/ipl1 rel...    46   2e-05
U58749-5|AAU05597.1| 1551|Caenorhabditis elegans Hypothetical pr...    46   2e-05
U58749-4|AAU05598.1| 1592|Caenorhabditis elegans Hypothetical pr...    46   2e-05
U40858-1|AAA83272.1| 1096|Caenorhabditis elegans serine/threonin...    46   2e-05
U22183-1|AAA97437.1| 1192|Caenorhabditis elegans serine/threonin...    46   2e-05
AF071207-1|AAC70945.1|  305|Caenorhabditis elegans aurora/Ipl1-r...    46   2e-05
U40416-1|AAA81410.2|  822|Caenorhabditis elegans Protein kinase ...    45   6e-05
AF403714-1|AAK97497.1|  822|Caenorhabditis elegans serine/threon...    45   6e-05
AF106583-5|AAD03136.1|  301|Caenorhabditis elegans Hypothetical ...    45   6e-05
Z81507-4|CAL49434.1|  598|Caenorhabditis elegans Hypothetical pr...    44   1e-04
Z49131-3|CAA88976.1| 1211|Caenorhabditis elegans Hypothetical pr...    44   1e-04
DQ523832-1|ABF71877.1|  598|Caenorhabditis elegans P21-activated...    44   1e-04
AL032639-12|CAL49443.1|  598|Caenorhabditis elegans Hypothetical...    44   1e-04
AL032639-11|CAA21637.2|  426|Caenorhabditis elegans Hypothetical...    44   1e-04
Z70207-8|CAM33501.1|  835|Caenorhabditis elegans Hypothetical pr...    44   1e-04
Z70207-5|CAA94127.2|  914|Caenorhabditis elegans Hypothetical pr...    44   1e-04
AF316542-1|AAG50270.1|  914|Caenorhabditis elegans serine/threon...    44   1e-04
Z66497-11|CAH19102.1|  238|Caenorhabditis elegans Hypothetical p...    44   2e-04
Z66497-10|CAH19101.1|  346|Caenorhabditis elegans Hypothetical p...    44   2e-04
Z66497-3|CAE48503.1|  363|Caenorhabditis elegans Hypothetical pr...    44   2e-04
Z66497-2|CAD59153.1|  336|Caenorhabditis elegans Hypothetical pr...    44   2e-04
Z66497-1|CAA91283.1|  521|Caenorhabditis elegans Hypothetical pr...    44   2e-04
Z75533-9|CAA99814.2|  772|Caenorhabditis elegans Hypothetical pr...    43   2e-04
AL117193-13|CAB55004.2|  478|Caenorhabditis elegans Hypothetical...    43   2e-04
AL032633-1|CAA21594.1|  430|Caenorhabditis elegans Hypothetical ...    43   3e-04
U53336-8|AAA96180.2|  326|Caenorhabditis elegans Aurora/ipl1 rel...    41   0.001
AF071206-1|AAC70944.1|  326|Caenorhabditis elegans aurora/Ipl1-r...    41   0.001
AF039037-1|AAO21431.1|  312|Caenorhabditis elegans Hypothetical ...    41   0.001
U55363-8|AAA97966.1|  829|Caenorhabditis elegans Germinal center...    41   0.001
AF125956-9|AAK68289.1|  318|Caenorhabditis elegans Hypothetical ...    41   0.001
AF125956-8|AAD14728.2|  678|Caenorhabditis elegans Hypothetical ...    41   0.001
AF125956-7|AAX55694.1|  657|Caenorhabditis elegans Hypothetical ...    41   0.001
Z73899-13|CAM35841.1| 6629|Caenorhabditis elegans Hypothetical p...    40   0.002
Z73899-11|CAA98082.2| 7158|Caenorhabditis elegans Hypothetical p...    40   0.002
Z73899-10|CAA98081.2| 6839|Caenorhabditis elegans Hypothetical p...    40   0.002
Z73897-6|CAM35838.1| 6629|Caenorhabditis elegans Hypothetical pr...    40   0.002
Z73897-5|CAA98065.2| 7158|Caenorhabditis elegans Hypothetical pr...    40   0.002
Z73897-4|CAA98064.2| 6839|Caenorhabditis elegans Hypothetical pr...    40   0.002
X15423-1|CAA33463.1| 6048|Caenorhabditis elegans twitchin protein.     40   0.002
AL110501-9|CAB54507.2|  802|Caenorhabditis elegans Hypothetical ...    40   0.003
AL033514-40|CAD36501.1|  802|Caenorhabditis elegans Hypothetical...    40   0.003
AJ319870-1|CAC67459.1|  802|Caenorhabditis elegans ZYG-8 protein...    40   0.003
AF039037-2|AAO21432.1|  324|Caenorhabditis elegans Hypothetical ...    39   0.004
Z74029-5|CAA98433.2|  520|Caenorhabditis elegans Hypothetical pr...    39   0.005
Z74029-4|CAA98429.2|  522|Caenorhabditis elegans Hypothetical pr...    39   0.005
DQ523831-1|ABF71876.1|  522|Caenorhabditis elegans P21-activated...    39   0.005
AF100655-2|AAK68684.2|  366|Caenorhabditis elegans Map kinase ac...    39   0.005
AF100655-1|AAC68944.1|  443|Caenorhabditis elegans Map kinase ac...    39   0.005
AC025716-18|AAT81178.1|  998|Caenorhabditis elegans Hypothetical...    39   0.005
AC024801-4|AAF59648.4|  485|Caenorhabditis elegans Hypothetical ...    38   0.006
AY733040-1|AAW57534.1| 1425|Caenorhabditis elegans death-associa...    38   0.011
AF043701-1|AAK18971.2| 1425|Caenorhabditis elegans Dap (death-as...    38   0.011
Z70279-14|CAC42329.1|  302|Caenorhabditis elegans Hypothetical p...    37   0.015
Z70279-13|CAC42328.1|  302|Caenorhabditis elegans Hypothetical p...    37   0.015
Z70279-12|CAC42322.1|  350|Caenorhabditis elegans Hypothetical p...    37   0.015
Z70279-11|CAC42324.1|  571|Caenorhabditis elegans Hypothetical p...    37   0.015
Z70279-10|CAC42323.1|  520|Caenorhabditis elegans Hypothetical p...    37   0.015
Z70279-9|CAC42327.1|  518|Caenorhabditis elegans Hypothetical pr...    37   0.015
Z70279-8|CAC42325.1|  533|Caenorhabditis elegans Hypothetical pr...    37   0.015
Z70279-7|CAC42326.1|  482|Caenorhabditis elegans Hypothetical pr...    37   0.015
Z70279-6|CAA94244.2|  720|Caenorhabditis elegans Hypothetical pr...    37   0.015
Z70279-4|CAA94242.2|  559|Caenorhabditis elegans Hypothetical pr...    37   0.015
Z34989-1|CAA84441.1|  404|Caenorhabditis elegans Ndr protein kin...    37   0.015
U41016-7|ABC71807.1|  476|Caenorhabditis elegans Sensory axon gu...    37   0.015
U41016-6|ABC71808.1|  474|Caenorhabditis elegans Sensory axon gu...    37   0.015
AL023841-12|CAC42367.1|  302|Caenorhabditis elegans Hypothetical...    37   0.015
AL023841-11|CAC42366.1|  302|Caenorhabditis elegans Hypothetical...    37   0.015
AL023841-10|CAC42360.1|  350|Caenorhabditis elegans Hypothetical...    37   0.015
AL023841-9|CAC42362.1|  571|Caenorhabditis elegans Hypothetical ...    37   0.015
AL023841-8|CAC42361.1|  520|Caenorhabditis elegans Hypothetical ...    37   0.015
AL023841-7|CAC42365.1|  518|Caenorhabditis elegans Hypothetical ...    37   0.015
AL023841-6|CAC42363.1|  533|Caenorhabditis elegans Hypothetical ...    37   0.015
AL023841-5|CAC42364.1|  482|Caenorhabditis elegans Hypothetical ...    37   0.015
AL023841-4|CAC42359.1|  720|Caenorhabditis elegans Hypothetical ...    37   0.015
AL023841-2|CAC42358.1|  559|Caenorhabditis elegans Hypothetical ...    37   0.015
AF275634-1|AAF91417.1|  469|Caenorhabditis elegans SAX-1 Ndr pro...    37   0.015
AF255956-1|AAF71543.1|  350|Caenorhabditis elegans calcium/calmo...    37   0.015
AF233267-1|AAF63325.1|  302|Caenorhabditis elegans calcium/calmo...    37   0.015
AF233266-1|AAF63324.1|  302|Caenorhabditis elegans calcium/calmo...    37   0.015
AF233265-1|AAF63323.1|  518|Caenorhabditis elegans calcium/calmo...    37   0.015
AF233264-1|AAF63322.1|  571|Caenorhabditis elegans calcium/calmo...    37   0.015
AF233263-1|AAF63321.1|  533|Caenorhabditis elegans calcium/calmo...    37   0.015
AF233262-1|AAF63320.1|  520|Caenorhabditis elegans calcium/calmo...    37   0.015
AF180735-1|AAD53949.1|  482|Caenorhabditis elegans calcium/calmo...    37   0.015
U58726-7|AAP13770.1|  562|Caenorhabditis elegans Amp-activated k...    37   0.020
U58726-6|AAM69095.1|  624|Caenorhabditis elegans Amp-activated k...    37   0.020
U58726-5|AAM69096.1|  626|Caenorhabditis elegans Amp-activated k...    37   0.020
U00034-3|AAL00850.1|  211|Caenorhabditis elegans Pim (mammalian ...    37   0.020
U00034-2|AAM15548.1|  378|Caenorhabditis elegans Pim (mammalian ...    37   0.020
U00034-1|AAA50639.2|  566|Caenorhabditis elegans Pim (mammalian ...    37   0.020
AY347273-1|AAR06928.1|  624|Caenorhabditis elegans AMP-activated...    37   0.020
AF125964-5|AAP13765.1|  722|Caenorhabditis elegans Hypothetical ...    36   0.026
AF125964-2|AAD14754.1|  726|Caenorhabditis elegans Hypothetical ...    36   0.026
AF039037-4|AAC48229.3|  311|Caenorhabditis elegans Protein kinas...    36   0.026
Z81594-1|CAB04745.1|  908|Caenorhabditis elegans Hypothetical pr...    36   0.045
Z70279-5|CAA94243.3|  137|Caenorhabditis elegans Hypothetical pr...    36   0.045
AL023841-3|CAC42357.1|  137|Caenorhabditis elegans Hypothetical ...    36   0.045
Z99277-6|CAB16484.1|  677|Caenorhabditis elegans Hypothetical pr...    35   0.060
Z83731-4|CAB06021.2|  471|Caenorhabditis elegans Hypothetical pr...    35   0.060
Z83217-5|CAB05684.2| 1565|Caenorhabditis elegans Hypothetical pr...    35   0.060
Z81460-3|CAB03829.1| 1228|Caenorhabditis elegans Hypothetical pr...    35   0.060
U63744-1|AAC47308.1|  572|Caenorhabditis elegans p21-activated k...    35   0.060
U29612-11|AAO61438.1|  523|Caenorhabditis elegans P21-activated ...    35   0.060
U29612-10|AAA68805.2|  572|Caenorhabditis elegans P21-activated ...    35   0.060
U29612-9|AAL65775.1|  569|Caenorhabditis elegans P21-activated k...    35   0.060
D83215-1|BAA11844.1|  569|Caenorhabditis elegans protein kinase ...    35   0.060
AM498742-1|CAM58448.1|  471|Caenorhabditis elegans MAP kinase pr...    35   0.060
AM086627-1|CAJ31105.1| 1565|Caenorhabditis elegans KIN-4 protein...    35   0.060
AF067607-4|AAF98610.2|  390|Caenorhabditis elegans Hypothetical ...    35   0.060
Z84574-8|CAE54891.1|  921|Caenorhabditis elegans Hypothetical pr...    35   0.079
Z84574-7|CAB06544.3|  928|Caenorhabditis elegans Hypothetical pr...    35   0.079
Z84574-1|CAE54890.1|  577|Caenorhabditis elegans Hypothetical pr...    35   0.079
Z81140-4|CAJ55247.1|  463|Caenorhabditis elegans Hypothetical pr...    35   0.079
Z81140-3|CAJ55246.1|  453|Caenorhabditis elegans Hypothetical pr...    35   0.079
Z48795-3|CAA88727.1|  414|Caenorhabditis elegans Hypothetical pr...    35   0.079
U41996-8|AAA83477.1|  310|Caenorhabditis elegans Hypothetical pr...    35   0.079
AL132846-4|CAB60347.1|  328|Caenorhabditis elegans Hypothetical ...    35   0.079
AL022593-4|CAE54889.1|  921|Caenorhabditis elegans Hypothetical ...    35   0.079
AL022593-3|CAA18635.3|  928|Caenorhabditis elegans Hypothetical ...    35   0.079
AF106583-4|AAD03135.1|  417|Caenorhabditis elegans Hypothetical ...    35   0.079
AF067608-9|AAC17652.1|  367|Caenorhabditis elegans Temporarily a...    35   0.079
U40935-5|AAM29686.1|  441|Caenorhabditis elegans Hypothetical pr...    34   0.10 
U40935-4|AAM29687.1|  436|Caenorhabditis elegans Hypothetical pr...    34   0.10 
AL032618-4|CAB63367.1|  353|Caenorhabditis elegans Hypothetical ...    34   0.10 
Z99276-2|CAB16482.1|  388|Caenorhabditis elegans Hypothetical pr...    34   0.14 
Z92967-2|CAB07478.1| 1101|Caenorhabditis elegans Hypothetical pr...    34   0.14 
Z82059-9|CAB04875.1|  292|Caenorhabditis elegans Hypothetical pr...    34   0.14 
Z82052-10|CAB04830.1| 1101|Caenorhabditis elegans Hypothetical p...    34   0.14 
U40943-4|AAK39236.1|  270|Caenorhabditis elegans Hypothetical pr...    34   0.14 
U40943-3|AAM69117.1|  325|Caenorhabditis elegans Hypothetical pr...    34   0.14 
U40943-1|AAK72061.2|  398|Caenorhabditis elegans Hypothetical pr...    34   0.14 
AL023843-2|CAA19523.1|  388|Caenorhabditis elegans Hypothetical ...    34   0.14 
AL021572-4|CAA16519.1| 1101|Caenorhabditis elegans Hypothetical ...    34   0.14 
AL021507-1|CAA16430.1| 1101|Caenorhabditis elegans Hypothetical ...    34   0.14 
AJ012357-1|CAB41352.1|  371|Caenorhabditis elegans cyclic AMP-de...    34   0.14 
AF129111-1|AAD37121.1|  292|Caenorhabditis elegans cell division...    34   0.14 
U80842-3|AAB37947.1|  325|Caenorhabditis elegans Serpentine rece...    33   0.18 
U41263-3|AAC24425.1|  361|Caenorhabditis elegans Hypothetical pr...    33   0.18 
AF003145-6|AAK68678.1| 1420|Caenorhabditis elegans Mtk1/mekk4 ho...    33   0.18 
AF003145-5|AAB57718.1| 1418|Caenorhabditis elegans Mtk1/mekk4 ho...    33   0.18 
Z34533-1|CAA84302.3|  730|Caenorhabditis elegans Hypothetical pr...    33   0.24 
U13876-6|AAA21175.2|  444|Caenorhabditis elegans Hypothetical pr...    33   0.24 
Z50873-1|CAA90760.2|  961|Caenorhabditis elegans Hypothetical pr...    33   0.32 
Z35637-1|CAA84687.1|  363|Caenorhabditis elegans Hypothetical pr...    33   0.32 
X92564-1|CAA63314.1|  961|Caenorhabditis elegans LIN-2A protein.       33   0.32 
U80845-5|ABB51196.1|  423|Caenorhabditis elegans Temporarily ass...    33   0.32 
U61958-1|AAB03183.1|  416|Caenorhabditis elegans Hypothetical pr...    33   0.32 
U57054-2|AAL50324.1|  372|Caenorhabditis elegans Jun n-terminal ...    33   0.32 
U57054-1|AAA98724.2|  463|Caenorhabditis elegans Jun n-terminal ...    33   0.32 
U00025-1|ABA54413.1|  589|Caenorhabditis elegans Amp-activated k...    33   0.32 
AY347272-1|AAR06927.1|  589|Caenorhabditis elegans AMP-activated...    33   0.32 
AY077615-1|AAL79359.1|  510|Caenorhabditis elegans KSR-2b protein.     33   0.32 
AY077614-1|AAL79358.1|  550|Caenorhabditis elegans KSR-2a protein.     33   0.32 
AL137227-5|CAB70240.2|  510|Caenorhabditis elegans Hypothetical ...    33   0.32 
AL137227-4|CAB70239.2|  550|Caenorhabditis elegans Hypothetical ...    33   0.32 
AF271359-1|AAF75788.1|  497|Caenorhabditis elegans STE20-like ki...    33   0.32 
AC006630-2|ABD63233.1|  495|Caenorhabditis elegans Hypothetical ...    33   0.32 
AC006630-1|ABD63234.1|  497|Caenorhabditis elegans Hypothetical ...    33   0.32 
AB024085-1|BAA82640.1|  463|Caenorhabditis elegans JNK-1 protein.      33   0.32 
Z80219-7|CAN86594.1|  804|Caenorhabditis elegans Hypothetical pr...    32   0.42 
Z80219-6|CAI70409.1|  734|Caenorhabditis elegans Hypothetical pr...    32   0.42 
Z80219-5|CAB02302.2|  784|Caenorhabditis elegans Hypothetical pr...    32   0.42 
Z80219-4|CAE17938.1|  745|Caenorhabditis elegans Hypothetical pr...    32   0.42 
Z80219-1|CAB02301.2|  727|Caenorhabditis elegans Hypothetical pr...    32   0.42 
Z75546-12|CAN86896.1|  804|Caenorhabditis elegans Hypothetical p...    32   0.42 
Z75546-11|CAI70402.1|  734|Caenorhabditis elegans Hypothetical p...    32   0.42 
Z75546-10|CAA99896.2|  784|Caenorhabditis elegans Hypothetical p...    32   0.42 
Z75546-9|CAE17895.1|  745|Caenorhabditis elegans Hypothetical pr...    32   0.42 
Z70750-9|CAA94735.2|  317|Caenorhabditis elegans Hypothetical pr...    32   0.42 
U13645-2|AAM15543.1|  367|Caenorhabditis elegans Hypothetical pr...    32   0.42 
U13645-1|AAA20987.2|  470|Caenorhabditis elegans Hypothetical pr...    32   0.42 
U58750-2|AAB00642.1|  615|Caenorhabditis elegans Polo kinase pro...    32   0.56 
AF100305-2|AAC68917.1|  320|Caenorhabditis elegans Hypothetical ...    32   0.56 
AF059024-1|AAC14425.1|  615|Caenorhabditis elegans polo-like kin...    32   0.56 
Z75541-2|CAA99854.2|  301|Caenorhabditis elegans Hypothetical pr...    31   0.74 
Z34800-4|CAA84323.2|  441|Caenorhabditis elegans Hypothetical pr...    31   0.74 
U53153-6|AAT81184.1|  638|Caenorhabditis elegans Germinal center...    31   0.74 
U53153-5|AAK77641.1|  651|Caenorhabditis elegans Germinal center...    31   0.74 
U53153-4|AAK77642.2|  650|Caenorhabditis elegans Germinal center...    31   0.74 
U53153-3|AAC69038.1|  653|Caenorhabditis elegans Germinal center...    31   0.74 
U41550-5|AAA83287.4|  402|Caenorhabditis elegans Hypothetical pr...    31   0.74 
Z49128-1|CAA88953.1|  379|Caenorhabditis elegans Hypothetical pr...    31   0.98 
U97407-1|AAB52478.2|  411|Caenorhabditis elegans Hypothetical pr...    31   0.98 
AC006814-3|AAF60861.1|  382|Caenorhabditis elegans Hypothetical ...    31   0.98 
Z81116-7|CAB03306.1|  669|Caenorhabditis elegans Hypothetical pr...    31   1.3  
Z70267-6|CAA94212.1|  255|Caenorhabditis elegans Hypothetical pr...    31   1.3  
Z69386-2|CAA93431.1|  305|Caenorhabditis elegans Hypothetical pr...    31   1.3  
Z50795-6|CAD59152.2|  707|Caenorhabditis elegans Hypothetical pr...    31   1.3  
Z50795-5|CAA90665.2|  705|Caenorhabditis elegans Hypothetical pr...    31   1.3  
U41031-1|AAA82618.2|  562|Caenorhabditis elegans Abnormal cell l...    31   1.3  
AY741200-1|AAU89102.1|  596|Caenorhabditis elegans STE20-like se...    31   1.3  
AL132898-15|CAC14417.2|  596|Caenorhabditis elegans Hypothetical...    31   1.3  
AF285179-1|AAG15377.1|  706|Caenorhabditis elegans zygote defect...    31   1.3  
AF133217-1|AAD24877.1|  583|Caenorhabditis elegans tyrosine kina...    31   1.3  
AF039715-5|AAB96730.1|  391|Caenorhabditis elegans Hypothetical ...    31   1.3  
AF003386-12|AAB54253.2|  706|Caenorhabditis elegans Zygote defec...    31   1.3  
Z99773-4|CAB16925.1|  342|Caenorhabditis elegans Hypothetical pr...    30   1.7  
Z99773-1|CAB16923.2|  406|Caenorhabditis elegans Hypothetical pr...    30   1.7  
Z50110-5|CAA90447.1|  342|Caenorhabditis elegans Hypothetical pr...    30   1.7  
Z36752-7|CAA85329.1|  468|Caenorhabditis elegans Hypothetical pr...    30   1.7  
U88311-7|AAB42348.1| 1173|Caenorhabditis elegans Lethal protein ...    30   1.7  
U88178-7|ABA03111.1|  439|Caenorhabditis elegans Hypothetical pr...    30   1.7  
U85515-1|AAB42081.1| 1173|Caenorhabditis elegans LET-502 protein.      30   1.7  
AY130758-5|AAN61521.1| 2693|Caenorhabditis elegans 301KDa_2 prot...    30   1.7  
AY130758-4|AAN61520.1| 2708|Caenorhabditis elegans 301KDa_1 prot...    30   1.7  
AY130758-2|AAN61518.1| 18519|Caenorhabditis elegans 2MDa_2 prote...    30   1.7  
AY130758-1|AAN61517.1| 18534|Caenorhabditis elegans 2MDa_1 prote...    30   1.7  
AF083878-1|AAD48898.1|  342|Caenorhabditis elegans cyclin-depend...    30   1.7  
AC006676-2|AAK71382.3|  439|Caenorhabditis elegans Hypothetical ...    30   1.7  
Z73103-5|CAA97422.1|  380|Caenorhabditis elegans Hypothetical pr...    30   2.3  
Z49131-2|CAA88975.1|  321|Caenorhabditis elegans Hypothetical pr...    30   2.3  
U97196-6|AAB52455.1|  373|Caenorhabditis elegans Hypothetical pr...    30   2.3  
U88172-11|AAB42257.1|  390|Caenorhabditis elegans Hypothetical p...    30   2.3  
U88172-10|AAM97988.1|  437|Caenorhabditis elegans Hypothetical p...    30   2.3  
AF475094-1|AAL84635.1|  533|Caenorhabditis elegans SRC-1 protein.      30   2.3  
AF419171-1|AAN31394.1|  533|Caenorhabditis elegans protein tyros...    30   2.3  
AC084161-5|AAK29735.4|  533|Caenorhabditis elegans Src oncogene ...    30   2.3  
AC024844-8|AAK29951.1|  421|Caenorhabditis elegans Hypothetical ...    30   2.3  
AC006615-7|AAK68227.1|  450|Caenorhabditis elegans Hypothetical ...    30   2.3  
Z79598-5|CAB01863.1|  367|Caenorhabditis elegans Hypothetical pr...    29   3.0  
Z66523-1|CAA91411.1|  361|Caenorhabditis elegans Hypothetical pr...    29   3.0  
Z49966-3|CAA90241.1|  361|Caenorhabditis elegans Hypothetical pr...    29   3.0  
U58754-7|AAB00674.1|  308|Caenorhabditis elegans Hypothetical pr...    29   3.0  
U44902-1|AAA93318.1|  483|Caenorhabditis elegans serine/threonin...    29   3.0  
U41994-13|AAK31527.2| 1425|Caenorhabditis elegans Neuronal symme...    29   3.0  
AL117202-13|CAB55075.1|  580|Caenorhabditis elegans Hypothetical...    29   3.0  
AL032634-2|CAC35855.1|  276|Caenorhabditis elegans Hypothetical ...    29   3.0  
AL021566-2|CAA16502.1|  283|Caenorhabditis elegans Hypothetical ...    29   3.0  
AF098992-12|AAC67453.2|  328|Caenorhabditis elegans Hypothetical...    29   3.0  
AC024770-6|AAF59485.2|  503|Caenorhabditis elegans Checkpoint ki...    29   3.0  
Z68104-8|CAA92117.1| 1077|Caenorhabditis elegans Hypothetical pr...    29   3.9  
Z66563-4|CAA91470.1| 1077|Caenorhabditis elegans Hypothetical pr...    29   3.9  
Z50029-6|CAD57714.1| 1072|Caenorhabditis elegans Hypothetical pr...    29   3.9  
Z50029-5|CAC42384.1| 1096|Caenorhabditis elegans Hypothetical pr...    29   3.9  
Z50029-4|CAB63417.1| 1082|Caenorhabditis elegans Hypothetical pr...    29   3.9  
Z50029-3|CAB63416.1| 1087|Caenorhabditis elegans Hypothetical pr...    29   3.9  
Z49132-8|CAA88987.1|  366|Caenorhabditis elegans Hypothetical pr...    29   3.9  
U55854-11|AAT81209.1|  570|Caenorhabditis elegans Map kinase pro...    29   3.9  
U55854-10|AAN60533.1|  426|Caenorhabditis elegans Map kinase pro...    29   3.9  
U55854-9|AAA98016.3|  605|Caenorhabditis elegans Map kinase prot...    29   3.9  
U53338-8|AAA96196.1|   85|Caenorhabditis elegans Fmrf-like pepti...    29   3.9  
U41994-8|AAK31524.1|  752|Caenorhabditis elegans Hypothetical pr...    29   3.9  
AF435953-1|AAL30829.1| 1077|Caenorhabditis elegans eIF2 alpha ki...    29   3.9  
AF193341-1|AAF61201.1| 1077|Caenorhabditis elegans eukaryotic tr...    29   3.9  
AF087131-1|AAD14593.1| 1087|Caenorhabditis elegans alternatively...    29   3.9  
AF042399-1|AAC08950.1|   85|Caenorhabditis elegans FMRFamide-lik...    29   3.9  
AF036701-1|AAB88368.2|  332|Caenorhabditis elegans Kinase, glh-b...    29   3.9  
AF016681-12|AAB66170.2|  325|Caenorhabditis elegans Serpentine r...    29   3.9  
AF003134-3|AAB54140.2|  314|Caenorhabditis elegans Hypothetical ...    29   3.9  
Z83127-6|CAB05633.1|  327|Caenorhabditis elegans Hypothetical pr...    29   5.2  
Z82096-17|CAD45623.1|  388|Caenorhabditis elegans Hypothetical p...    29   5.2  
Z82096-16|CAD45622.1|  386|Caenorhabditis elegans Hypothetical p...    29   5.2  
Z82096-15|CAD45621.1|  397|Caenorhabditis elegans Hypothetical p...    29   5.2  
Z82096-14|CAD45620.1|  359|Caenorhabditis elegans Hypothetical p...    29   5.2  
Z82096-13|CAD45619.1|  381|Caenorhabditis elegans Hypothetical p...    29   5.2  
Z82096-12|CAD45618.1|  343|Caenorhabditis elegans Hypothetical p...    29   5.2  
Z82096-11|CAD45617.1|  370|Caenorhabditis elegans Hypothetical p...    29   5.2  
Z82096-10|CAD45616.1|  404|Caenorhabditis elegans Hypothetical p...    29   5.2  
Z82096-9|CAB05035.1|  375|Caenorhabditis elegans Hypothetical pr...    29   5.2  
Z82096-8|CAB05034.1|  359|Caenorhabditis elegans Hypothetical pr...    29   5.2  
Z82096-5|CAD45615.1|  349|Caenorhabditis elegans Hypothetical pr...    29   5.2  
Z82096-4|CAD45614.1|  365|Caenorhabditis elegans Hypothetical pr...    29   5.2  
Z82096-3|CAD45613.1|  548|Caenorhabditis elegans Hypothetical pr...    29   5.2  
Z81511-12|CAD45590.1|  388|Caenorhabditis elegans Hypothetical p...    29   5.2  
Z81511-11|CAD45589.1|  386|Caenorhabditis elegans Hypothetical p...    29   5.2  
Z81511-10|CAD45588.1|  397|Caenorhabditis elegans Hypothetical p...    29   5.2  
Z81511-9|CAD45587.1|  359|Caenorhabditis elegans Hypothetical pr...    29   5.2  
Z81511-8|CAD45586.1|  381|Caenorhabditis elegans Hypothetical pr...    29   5.2  
Z81511-7|CAD45585.1|  343|Caenorhabditis elegans Hypothetical pr...    29   5.2  
Z81511-6|CAD45584.1|  370|Caenorhabditis elegans Hypothetical pr...    29   5.2  
Z81511-5|CAD45583.1|  404|Caenorhabditis elegans Hypothetical pr...    29   5.2  
Z81511-4|CAB04169.1|  375|Caenorhabditis elegans Hypothetical pr...    29   5.2  
Z81511-3|CAB04168.1|  359|Caenorhabditis elegans Hypothetical pr...    29   5.2  
Z80214-6|CAB02266.1|  327|Caenorhabditis elegans Hypothetical pr...    29   5.2  
Z73975-1|CAA98276.1|  282|Caenorhabditis elegans Hypothetical pr...    29   5.2  
U97001-5|AAB52260.3| 1592|Caenorhabditis elegans Temporarily ass...    29   5.2  
AL021483-2|CAA16345.1|  308|Caenorhabditis elegans Hypothetical ...    29   5.2  
AF194964-1|AAF28314.1|  632|Caenorhabditis elegans polo-like kin...    29   5.2  
AF154004-1|AAD38186.1|  330|Caenorhabditis elegans cyclin-depend...    29   5.2  
AC024770-7|AAP13756.1|  411|Caenorhabditis elegans Checkpoint ki...    29   5.2  
AC024766-2|AAK68887.2|  330|Caenorhabditis elegans Cyclin-depend...    29   5.2  
AC024201-9|AAF36014.1|  632|Caenorhabditis elegans Polo kinase p...    29   5.2  
AF125964-1|AAD14753.1|  471|Caenorhabditis elegans Hypothetical ...    25   6.0  
Z81109-17|CAB03241.2|  497|Caenorhabditis elegans Hypothetical p...    28   6.9  
Z54342-11|CAA91146.1|  502|Caenorhabditis elegans Hypothetical p...    28   6.9  
U41532-4|AAK68320.1|  767|Caenorhabditis elegans Hypothetical pr...    28   6.9  
U41532-3|AAK68319.1|  797|Caenorhabditis elegans Hypothetical pr...    28   6.9  
U28929-1|AAN63410.1|  418|Caenorhabditis elegans Hypothetical pr...    28   6.9  
U23453-9|AAC46755.1|  727|Caenorhabditis elegans Hypothetical pr...    28   6.9  
U14634-2|AAA21560.2|  423|Caenorhabditis elegans Hypothetical pr...    28   6.9  
Z92797-4|CAB07238.3|  478|Caenorhabditis elegans Hypothetical pr...    28   9.1  
Z92797-3|CAB07237.2|  445|Caenorhabditis elegans Hypothetical pr...    28   9.1  
Z83118-3|CAB05577.3|  478|Caenorhabditis elegans Hypothetical pr...    28   9.1  
Z83118-2|CAB05576.2|  445|Caenorhabditis elegans Hypothetical pr...    28   9.1  
M37119-1|AAA51610.1|  375|Caenorhabditis elegans cAMP-dependent ...    28   9.1  
L15347-1|AAA28142.1|  813|Caenorhabditis elegans raf proto-oncog...    28   9.1  
AY493414-1|AAR86713.1|  769|Caenorhabditis elegans LIN-45 isofor...    28   9.1  
AY493413-1|AAR86712.1|  813|Caenorhabditis elegans LIN-45 isofor...    28   9.1  
AY455928-1|AAR26307.1|  813|Caenorhabditis elegans LIN-45 protein.     28   9.1  
AF038618-10|AAB92065.2|  474|Caenorhabditis elegans P38 map kina...    28   9.1  
AF003134-4|AAB54145.2|  395|Caenorhabditis elegans Hypothetical ...    28   9.1  
AC024204-6|AAF36042.1|  813|Caenorhabditis elegans Abnormal cell...    28   9.1  

>AY350451-1|AAQ54691.1|  332|Caenorhabditis elegans
           calcium/calmodulin-dependent proteinkinase 1 protein.
          Length = 332

 Score = 49.2 bits (112), Expect = 3e-06
 Identities = 24/80 (30%), Positives = 46/80 (57%)
 Frame = -3

Query: 241 DEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIR 62
           +EIKV + +  H N ++++  +       +VM+ +   +LF+ +  KG  + Q  SN+IR
Sbjct: 52  NEIKVLRKLR-HNNIVQLFDTYDEKQFVYLVMELVTGGELFDRIVAKGSYTEQDASNLIR 110

Query: 61  QLCEALNDLHKHNFIHNDIK 2
           Q+ EA+  +H +  +H D+K
Sbjct: 111 QVLEAVGFMHDNGVVHRDLK 130


>AF099924-1|AAF23187.1|  348|Caenorhabditis elegans Cam kinase
           protein 1 protein.
          Length = 348

 Score = 49.2 bits (112), Expect = 3e-06
 Identities = 24/80 (30%), Positives = 46/80 (57%)
 Frame = -3

Query: 241 DEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIR 62
           +EIKV + +  H N ++++  +       +VM+ +   +LF+ +  KG  + Q  SN+IR
Sbjct: 68  NEIKVLRKLR-HNNIVQLFDTYDEKQFVYLVMELVTGGELFDRIVAKGSYTEQDASNLIR 126

Query: 61  QLCEALNDLHKHNFIHNDIK 2
           Q+ EA+  +H +  +H D+K
Sbjct: 127 QVLEAVGFMHDNGVVHRDLK 146


>AB021864-1|BAA82674.1|  348|Caenorhabditis elegans
           Ca2+/calmodulin-dependent proteinkinase I protein.
          Length = 348

 Score = 49.2 bits (112), Expect = 3e-06
 Identities = 24/80 (30%), Positives = 46/80 (57%)
 Frame = -3

Query: 241 DEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIR 62
           +EIKV + +  H N ++++  +       +VM+ +   +LF+ +  KG  + Q  SN+IR
Sbjct: 68  NEIKVLRKLR-HNNIVQLFDTYDEKQFVYLVMELVTGGELFDRIVAKGSYTEQDASNLIR 126

Query: 61  QLCEALNDLHKHNFIHNDIK 2
           Q+ EA+  +H +  +H D+K
Sbjct: 127 QVLEAVGFMHDNGVVHRDLK 146


>Z83228-3|CAB60998.1|  536|Caenorhabditis elegans Hypothetical
           protein F52F12.3 protein.
          Length = 536

 Score = 48.0 bits (109), Expect = 8e-06
 Identities = 26/84 (30%), Positives = 48/84 (57%), Gaps = 3/84 (3%)
 Frame = -3

Query: 244 VDEIKVHQLMNDHPNFIKIY-FNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQL--VS 74
           + E KV   + +HPN IKIY       N Q +VM+Y+DC  + + L  +  +++ +  V+
Sbjct: 95  IREAKVMWDLRNHPNIIKIYGLYKSPRNGQGVVMEYMDCGSMADLLYDRTHINYTIDHVA 154

Query: 73  NIIRQLCEALNDLHKHNFIHNDIK 2
           + + QL  A++  H ++ +H D+K
Sbjct: 155 SWMFQLSSAVDFFHSNSQVHRDLK 178


>AF145377-1|AAD39816.1|  536|Caenorhabditis elegans MOM-4 protein.
          Length = 536

 Score = 48.0 bits (109), Expect = 8e-06
 Identities = 26/84 (30%), Positives = 48/84 (57%), Gaps = 3/84 (3%)
 Frame = -3

Query: 244 VDEIKVHQLMNDHPNFIKIY-FNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQL--VS 74
           + E KV   + +HPN IKIY       N Q +VM+Y+DC  + + L  +  +++ +  V+
Sbjct: 95  IREAKVMWDLRNHPNIIKIYGLYKSPRNGQGVVMEYMDCGSMADLLYDRTHINYTIDHVA 154

Query: 73  NIIRQLCEALNDLHKHNFIHNDIK 2
           + + QL  A++  H ++ +H D+K
Sbjct: 155 SWMFQLSSAVDFFHSNSQVHRDLK 178


>AF143242-1|AAD37359.1|  536|Caenorhabditis elegans protein kinase
           MOM-4 protein.
          Length = 536

 Score = 48.0 bits (109), Expect = 8e-06
 Identities = 26/84 (30%), Positives = 48/84 (57%), Gaps = 3/84 (3%)
 Frame = -3

Query: 244 VDEIKVHQLMNDHPNFIKIY-FNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQL--VS 74
           + E KV   + +HPN IKIY       N Q +VM+Y+DC  + + L  +  +++ +  V+
Sbjct: 95  IREAKVMWDLRNHPNIIKIYGLYKSPRNGQGVVMEYMDCGSMADLLYDRTHINYTIDHVA 154

Query: 73  NIIRQLCEALNDLHKHNFIHNDIK 2
           + + QL  A++  H ++ +H D+K
Sbjct: 155 SWMFQLSSAVDFFHSNSQVHRDLK 178


>Z96102-6|CAJ85756.1| 1062|Caenorhabditis elegans Hypothetical
           protein H39E23.1c protein.
          Length = 1062

 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 23/79 (29%), Positives = 40/79 (50%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+K+ + + DHPN +K+Y          +V++Y    ++F+ L   G +  +      RQ
Sbjct: 87  EVKIMKQL-DHPNIVKLYQVMETEQTLYLVLEYASGGEVFDYLVAHGRMKEKEARAKFRQ 145

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  A+  LH  N IH D+K
Sbjct: 146 IVSAVQYLHSKNIIHRDLK 164


>Z96102-5|CAB54262.2| 1096|Caenorhabditis elegans Hypothetical
           protein H39E23.1b protein.
          Length = 1096

 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 23/79 (29%), Positives = 40/79 (50%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+K+ + + DHPN +K+Y          +V++Y    ++F+ L   G +  +      RQ
Sbjct: 169 EVKIMKQL-DHPNIVKLYQVMETEQTLYLVLEYASGGEVFDYLVAHGRMKEKEARAKFRQ 227

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  A+  LH  N IH D+K
Sbjct: 228 IVSAVQYLHSKNIIHRDLK 246


>Z96102-4|CAB54263.1| 1192|Caenorhabditis elegans Hypothetical
           protein H39E23.1a protein.
          Length = 1192

 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 23/79 (29%), Positives = 40/79 (50%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+K+ + + DHPN +K+Y          +V++Y    ++F+ L   G +  +      RQ
Sbjct: 217 EVKIMKQL-DHPNIVKLYQVMETEQTLYLVLEYASGGEVFDYLVAHGRMKEKEARAKFRQ 275

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  A+  LH  N IH D+K
Sbjct: 276 IVSAVQYLHSKNIIHRDLK 294


>Z81027-7|CAJ85745.1| 1062|Caenorhabditis elegans Hypothetical
           protein H39E23.1c protein.
          Length = 1062

 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 23/79 (29%), Positives = 40/79 (50%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+K+ + + DHPN +K+Y          +V++Y    ++F+ L   G +  +      RQ
Sbjct: 87  EVKIMKQL-DHPNIVKLYQVMETEQTLYLVLEYASGGEVFDYLVAHGRMKEKEARAKFRQ 145

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  A+  LH  N IH D+K
Sbjct: 146 IVSAVQYLHSKNIIHRDLK 164


>Z81027-6|CAB54178.2| 1096|Caenorhabditis elegans Hypothetical
           protein H39E23.1b protein.
          Length = 1096

 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 23/79 (29%), Positives = 40/79 (50%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+K+ + + DHPN +K+Y          +V++Y    ++F+ L   G +  +      RQ
Sbjct: 169 EVKIMKQL-DHPNIVKLYQVMETEQTLYLVLEYASGGEVFDYLVAHGRMKEKEARAKFRQ 227

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  A+  LH  N IH D+K
Sbjct: 228 IVSAVQYLHSKNIIHRDLK 246


>Z81027-5|CAB54179.1| 1192|Caenorhabditis elegans Hypothetical
           protein H39E23.1a protein.
          Length = 1192

 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 23/79 (29%), Positives = 40/79 (50%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+K+ + + DHPN +K+Y          +V++Y    ++F+ L   G +  +      RQ
Sbjct: 217 EVKIMKQL-DHPNIVKLYQVMETEQTLYLVLEYASGGEVFDYLVAHGRMKEKEARAKFRQ 275

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  A+  LH  N IH D+K
Sbjct: 276 IVSAVQYLHSKNIIHRDLK 294


>Z74031-18|CAA98453.3|  333|Caenorhabditis elegans Hypothetical
           protein F32D8.1 protein.
          Length = 333

 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 28/87 (32%), Positives = 44/87 (50%), Gaps = 1/87 (1%)
 Frame = -3

Query: 259 GANFNVD-EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQ 83
           G  F VD E+++  L+  H + I I       N   IV ++    DL+ET++  G +   
Sbjct: 109 GKCFFVDNEVEMLSLIQ-HDHIISIIDAFSTENQYFIVFEHAQYGDLYETIRKNGRIEEP 167

Query: 82  LVSNIIRQLCEALNDLHKHNFIHNDIK 2
             + I  Q+  ALN LH+ N +H D+K
Sbjct: 168 DAAIITLQVASALNYLHERNVVHRDVK 194


>U97196-3|AAB52459.2|  305|Caenorhabditis elegans Aurora/ipl1
           related kinase protein2 protein.
          Length = 305

 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 22/79 (27%), Positives = 41/79 (51%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI++   +N HPN IK+Y          +V++Y    ++++ L +    S    +  + +
Sbjct: 78  EIEIQSHLN-HPNIIKLYTYFWDAKKIYLVLEYAPGGEMYKQLTVSKRFSEPTAAKYMYE 136

Query: 58  LCEALNDLHKHNFIHNDIK 2
           + +AL+  H+ N IH DIK
Sbjct: 137 IADALSYCHRKNVIHRDIK 155


>U58749-5|AAU05597.1| 1551|Caenorhabditis elegans Hypothetical
           protein B0496.3a protein.
          Length = 1551

 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 25/79 (31%), Positives = 40/79 (50%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI++   +N HPN I+IY      +  ++VM+Y    +L++ +   G L       I RQ
Sbjct: 123 EIRIMSALN-HPNIIQIYEVFENKDKIILVMEYSSGGELYDYVSRCGSLPEAEARRIFRQ 181

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  A+   HKH   H D+K
Sbjct: 182 ITSAVLYCHKHRVAHRDLK 200


>U58749-4|AAU05598.1| 1592|Caenorhabditis elegans Hypothetical
           protein B0496.3b protein.
          Length = 1592

 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 25/79 (31%), Positives = 40/79 (50%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI++   +N HPN I+IY      +  ++VM+Y    +L++ +   G L       I RQ
Sbjct: 123 EIRIMSALN-HPNIIQIYEVFENKDKIILVMEYSSGGELYDYVSRCGSLPEAEARRIFRQ 181

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  A+   HKH   H D+K
Sbjct: 182 ITSAVLYCHKHRVAHRDLK 200


>U40858-1|AAA83272.1| 1096|Caenorhabditis elegans serine/threonine
           kinase protein.
          Length = 1096

 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 23/79 (29%), Positives = 40/79 (50%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+K+ + + DHPN +K+Y          +V++Y    ++F+ L   G +  +      RQ
Sbjct: 169 EVKIMKQL-DHPNIVKLYQVMETEQTLYLVLEYASGGEVFDYLVAHGRMKEKEARAKFRQ 227

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  A+  LH  N IH D+K
Sbjct: 228 IVSAVQYLHSKNIIHRDLK 246


>U22183-1|AAA97437.1| 1192|Caenorhabditis elegans serine/threonine
           kinase protein.
          Length = 1192

 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 23/79 (29%), Positives = 40/79 (50%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+K+ + + DHPN +K+Y          +V++Y    ++F+ L   G +  +      RQ
Sbjct: 217 EVKIMKQL-DHPNIVKLYQVMETEQTLYLVLEYASGGEVFDYLVAHGRMKEKEARAKFRQ 275

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  A+  LH  N IH D+K
Sbjct: 276 IVSAVQYLHSKNIIHRDLK 294


>AF071207-1|AAC70945.1|  305|Caenorhabditis elegans
           aurora/Ipl1-related protein kinase2 protein.
          Length = 305

 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 22/79 (27%), Positives = 41/79 (51%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI++   +N HPN IK+Y          +V++Y    ++++ L +    S    +  + +
Sbjct: 78  EIEIQSHLN-HPNIIKLYTYFWDAKKIYLVLEYAPGGEMYKQLTVSKRFSEPTAAKYMYE 136

Query: 58  LCEALNDLHKHNFIHNDIK 2
           + +AL+  H+ N IH DIK
Sbjct: 137 IADALSYCHRKNVIHRDIK 155


>U40416-1|AAA81410.2|  822|Caenorhabditis elegans Protein kinase
           protein 29 protein.
          Length = 822

 Score = 45.2 bits (102), Expect = 6e-05
 Identities = 23/79 (29%), Positives = 40/79 (50%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+K+ +++ DHP+ +K Y      N   IV +Y    +L+ETL  KG ++  +      +
Sbjct: 63  EVKIVKVI-DHPHIVKSYEIMRVDNMLYIVSEYCSSGELYETLIEKGRVAENVARKWFSE 121

Query: 58  LCEALNDLHKHNFIHNDIK 2
              A+  LH    +H D+K
Sbjct: 122 TASAVAYLHSQGIVHRDLK 140


>AF403714-1|AAK97497.1|  822|Caenorhabditis elegans serine/threonine
           kinase KIN-29 protein.
          Length = 822

 Score = 45.2 bits (102), Expect = 6e-05
 Identities = 23/79 (29%), Positives = 40/79 (50%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+K+ +++ DHP+ +K Y      N   IV +Y    +L+ETL  KG ++  +      +
Sbjct: 63  EVKIVKVI-DHPHIVKSYEIMRVDNMLYIVSEYCSSGELYETLIEKGRVAENVARKWFSE 121

Query: 58  LCEALNDLHKHNFIHNDIK 2
              A+  LH    +H D+K
Sbjct: 122 TASAVAYLHSQGIVHRDLK 140


>AF106583-5|AAD03136.1|  301|Caenorhabditis elegans Hypothetical
           protein F23C8.8 protein.
          Length = 301

 Score = 45.2 bits (102), Expect = 6e-05
 Identities = 23/53 (43%), Positives = 30/53 (56%), Gaps = 1/53 (1%)
 Frame = -3

Query: 157 VIVMDYIDCPDLFE-TLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           VI+ DY +   L E  LQ K    H L + + RQL EA+N LHK   +H D+K
Sbjct: 99  VIISDYYERGTLLEWILQKKRLKEHPLAATLFRQLIEAINYLHKRGIVHRDVK 151


>Z81507-4|CAL49434.1|  598|Caenorhabditis elegans Hypothetical
           protein Y38F1A.10a protein.
          Length = 598

 Score = 44.4 bits (100), Expect = 1e-04
 Identities = 24/80 (30%), Positives = 48/80 (60%), Gaps = 1/80 (1%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQV-IVMDYIDCPDLFETLQIKGELSHQLVSNIIR 62
           EIKV +    HPN +    ++    + + +VMDY++  +L + + +K EL    ++ +++
Sbjct: 373 EIKVMKQYR-HPNLVNYIESYLVDADDLWVVMDYLEGGNLTDVV-VKTELDEGQIAAVLQ 430

Query: 61  QLCEALNDLHKHNFIHNDIK 2
           +  +AL+ LH+H+ +H DIK
Sbjct: 431 ECLKALHFLHRHSIVHRDIK 450


>Z49131-3|CAA88976.1| 1211|Caenorhabditis elegans Hypothetical
           protein ZC373.4 protein.
          Length = 1211

 Score = 44.4 bits (100), Expect = 1e-04
 Identities = 25/71 (35%), Positives = 41/71 (57%), Gaps = 2/71 (2%)
 Frame = -3

Query: 208 HPNFIKIYFN-HGFINNQVIVMDYIDCPDLFETLQIKGE-LSHQLVSNIIRQLCEALNDL 35
           HP   +IY   +   N+ V++M+ +   +LF+ +  +   LS   V  II QLCEA++ +
Sbjct: 99  HPRIAQIYDAFYTTTNDVVLIMEIVRGGELFDRVAEESYVLSELAVVMIICQLCEAIDYI 158

Query: 34  HKHNFIHNDIK 2
           HK N +H D+K
Sbjct: 159 HKQNILHLDVK 169


>DQ523832-1|ABF71877.1|  598|Caenorhabditis elegans P21-activated
           kinase MAX-2 protein.
          Length = 598

 Score = 44.4 bits (100), Expect = 1e-04
 Identities = 24/80 (30%), Positives = 48/80 (60%), Gaps = 1/80 (1%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQV-IVMDYIDCPDLFETLQIKGELSHQLVSNIIR 62
           EIKV +    HPN +    ++    + + +VMDY++  +L + + +K EL    ++ +++
Sbjct: 373 EIKVMKQYR-HPNLVNYIESYLVDADDLWVVMDYLEGGNLTDVV-VKTELDEGQIAAVLQ 430

Query: 61  QLCEALNDLHKHNFIHNDIK 2
           +  +AL+ LH+H+ +H DIK
Sbjct: 431 ECLKALHFLHRHSIVHRDIK 450


>AL032639-12|CAL49443.1|  598|Caenorhabditis elegans Hypothetical
           protein Y38F1A.10a protein.
          Length = 598

 Score = 44.4 bits (100), Expect = 1e-04
 Identities = 24/80 (30%), Positives = 48/80 (60%), Gaps = 1/80 (1%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQV-IVMDYIDCPDLFETLQIKGELSHQLVSNIIR 62
           EIKV +    HPN +    ++    + + +VMDY++  +L + + +K EL    ++ +++
Sbjct: 373 EIKVMKQYR-HPNLVNYIESYLVDADDLWVVMDYLEGGNLTDVV-VKTELDEGQIAAVLQ 430

Query: 61  QLCEALNDLHKHNFIHNDIK 2
           +  +AL+ LH+H+ +H DIK
Sbjct: 431 ECLKALHFLHRHSIVHRDIK 450


>AL032639-11|CAA21637.2|  426|Caenorhabditis elegans Hypothetical
           protein Y38F1A.10b protein.
          Length = 426

 Score = 44.4 bits (100), Expect = 1e-04
 Identities = 24/80 (30%), Positives = 48/80 (60%), Gaps = 1/80 (1%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQV-IVMDYIDCPDLFETLQIKGELSHQLVSNIIR 62
           EIKV +    HPN +    ++    + + +VMDY++  +L + + +K EL    ++ +++
Sbjct: 201 EIKVMKQYR-HPNLVNYIESYLVDADDLWVVMDYLEGGNLTDVV-VKTELDEGQIAAVLQ 258

Query: 61  QLCEALNDLHKHNFIHNDIK 2
           +  +AL+ LH+H+ +H DIK
Sbjct: 259 ECLKALHFLHRHSIVHRDIK 278


>Z70207-8|CAM33501.1|  835|Caenorhabditis elegans Hypothetical
           protein F15A2.6b protein.
          Length = 835

 Score = 44.0 bits (99), Expect = 1e-04
 Identities = 22/79 (27%), Positives = 42/79 (53%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI + +L+ +HP+ + +Y  +       ++++++   +LF+ L  KG L  +      RQ
Sbjct: 94  EIAIMKLI-EHPHVLHLYDVYENKKYLYLLLEHVSGGELFDYLVRKGRLMSKEARKFFRQ 152

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  AL+  H HN  H D+K
Sbjct: 153 IISALDFCHAHNICHRDLK 171


>Z70207-5|CAA94127.2|  914|Caenorhabditis elegans Hypothetical
           protein F15A2.6a protein.
          Length = 914

 Score = 44.0 bits (99), Expect = 1e-04
 Identities = 22/79 (27%), Positives = 42/79 (53%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI + +L+ +HP+ + +Y  +       ++++++   +LF+ L  KG L  +      RQ
Sbjct: 94  EIAIMKLI-EHPHVLHLYDVYENKKYLYLLLEHVSGGELFDYLVRKGRLMSKEARKFFRQ 152

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  AL+  H HN  H D+K
Sbjct: 153 IISALDFCHAHNICHRDLK 171


>AF316542-1|AAG50270.1|  914|Caenorhabditis elegans serine/threonine
           kinase SAD-1 protein.
          Length = 914

 Score = 44.0 bits (99), Expect = 1e-04
 Identities = 22/79 (27%), Positives = 42/79 (53%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI + +L+ +HP+ + +Y  +       ++++++   +LF+ L  KG L  +      RQ
Sbjct: 94  EIAIMKLI-EHPHVLHLYDVYENKKYLYLLLEHVSGGELFDYLVRKGRLMSKEARKFFRQ 152

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  AL+  H HN  H D+K
Sbjct: 153 IISALDFCHAHNICHRDLK 171


>Z66497-11|CAH19102.1|  238|Caenorhabditis elegans Hypothetical
           protein K08F8.1e protein.
          Length = 238

 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 26/85 (30%), Positives = 46/85 (54%), Gaps = 6/85 (7%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIY--FNHGFINNQVIVM--DYIDCPDLFETLQIKGELSH--QLV 77
           E+++H L N H N + I   + + F N + ++M  ++++  DL    + +G + +  + V
Sbjct: 26  EVELHWLTNAHENVVSILDIYENTFDNVKCLLMVVEFLEGGDLLSQFESQGSIPYTEKKV 85

Query: 76  SNIIRQLCEALNDLHKHNFIHNDIK 2
             IIRQ+  A+  LH  N  H DIK
Sbjct: 86  GEIIRQIGNAVMYLHDMNIAHRDIK 110


>Z66497-10|CAH19101.1|  346|Caenorhabditis elegans Hypothetical
           protein K08F8.1d protein.
          Length = 346

 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 26/85 (30%), Positives = 46/85 (54%), Gaps = 6/85 (7%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIY--FNHGFINNQVIVM--DYIDCPDLFETLQIKGELSH--QLV 77
           E+++H L N H N + I   + + F N + ++M  ++++  DL    + +G + +  + V
Sbjct: 134 EVELHWLTNAHENVVSILDIYENTFDNVKCLLMVVEFLEGGDLLSQFESQGSIPYTEKKV 193

Query: 76  SNIIRQLCEALNDLHKHNFIHNDIK 2
             IIRQ+  A+  LH  N  H DIK
Sbjct: 194 GEIIRQIGNAVMYLHDMNIAHRDIK 218


>Z66497-3|CAE48503.1|  363|Caenorhabditis elegans Hypothetical
           protein K08F8.1c protein.
          Length = 363

 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 26/85 (30%), Positives = 46/85 (54%), Gaps = 6/85 (7%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIY--FNHGFINNQVIVM--DYIDCPDLFETLQIKGELSH--QLV 77
           E+++H L N H N + I   + + F N + ++M  ++++  DL    + +G + +  + V
Sbjct: 26  EVELHWLTNAHENVVSILDIYENTFDNVKCLLMVVEFLEGGDLLSQFESQGSIPYTEKKV 85

Query: 76  SNIIRQLCEALNDLHKHNFIHNDIK 2
             IIRQ+  A+  LH  N  H DIK
Sbjct: 86  GEIIRQIGNAVMYLHDMNIAHRDIK 110


>Z66497-2|CAD59153.1|  336|Caenorhabditis elegans Hypothetical
           protein K08F8.1b protein.
          Length = 336

 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 26/85 (30%), Positives = 46/85 (54%), Gaps = 6/85 (7%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIY--FNHGFINNQVIVM--DYIDCPDLFETLQIKGELSH--QLV 77
           E+++H L N H N + I   + + F N + ++M  ++++  DL    + +G + +  + V
Sbjct: 184 EVELHWLTNAHENVVSILDIYENTFDNVKCLLMVVEFLEGGDLLSQFESQGSIPYTEKKV 243

Query: 76  SNIIRQLCEALNDLHKHNFIHNDIK 2
             IIRQ+  A+  LH  N  H DIK
Sbjct: 244 GEIIRQIGNAVMYLHDMNIAHRDIK 268


>Z66497-1|CAA91283.1|  521|Caenorhabditis elegans Hypothetical
           protein K08F8.1a protein.
          Length = 521

 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 26/85 (30%), Positives = 46/85 (54%), Gaps = 6/85 (7%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIY--FNHGFINNQVIVM--DYIDCPDLFETLQIKGELSH--QLV 77
           E+++H L N H N + I   + + F N + ++M  ++++  DL    + +G + +  + V
Sbjct: 184 EVELHWLTNAHENVVSILDIYENTFDNVKCLLMVVEFLEGGDLLSQFESQGSIPYTEKKV 243

Query: 76  SNIIRQLCEALNDLHKHNFIHNDIK 2
             IIRQ+  A+  LH  N  H DIK
Sbjct: 244 GEIIRQIGNAVMYLHDMNIAHRDIK 268


>Z75533-9|CAA99814.2|  772|Caenorhabditis elegans Hypothetical
           protein C54G4.1a protein.
          Length = 772

 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 19/79 (24%), Positives = 42/79 (53%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E ++ +++  HPN ++++  H    +  +VM+ +   +L E ++     +    ++I+RQ
Sbjct: 424 EARILEMVQGHPNIVQLHDVHSDPLHFYLVMEILTGNELLERIRKLERFTESEAADIMRQ 483

Query: 58  LCEALNDLHKHNFIHNDIK 2
           L  A+  LH    +H D+K
Sbjct: 484 LVSAVKYLHDKRIVHRDLK 502



 Score = 35.5 bits (78), Expect = 0.045
 Identities = 19/79 (24%), Positives = 38/79 (48%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E +V + +   P  + +++         IVM+Y+   +LF  L  +G    +    +I +
Sbjct: 69  ERQVLERLRGTPFLVNLFYAFQTDTKLHIVMEYVRGGELFTHLCSRGHFDLEAARFVIAE 128

Query: 58  LCEALNDLHKHNFIHNDIK 2
           L  A++ LH+   I+ D+K
Sbjct: 129 LVVAIDSLHQRKVIYRDLK 147


>AL117193-13|CAB55004.2|  478|Caenorhabditis elegans Hypothetical
           protein Y105C5A.24 protein.
          Length = 478

 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 23/75 (30%), Positives = 42/75 (56%), Gaps = 3/75 (4%)
 Frame = -3

Query: 217 MNDHPNFIKIY-FNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQL--VSNIIRQLCEA 47
           + +H N IKIY       N Q +VM+Y+DC  + + +  +  + +++  V++ + QL  A
Sbjct: 96  LRNHVNIIKIYGMYESHRNGQGLVMEYMDCGCVADLIYDRKNIEYKMDHVASWMYQLSSA 155

Query: 46  LNDLHKHNFIHNDIK 2
           +N  H  + IH D+K
Sbjct: 156 VNFFHSKDQIHRDLK 170


>AL032633-1|CAA21594.1|  430|Caenorhabditis elegans Hypothetical
           protein Y106G6A.1 protein.
          Length = 430

 Score = 42.7 bits (96), Expect = 3e-04
 Identities = 21/55 (38%), Positives = 30/55 (54%)
 Frame = -3

Query: 166 NNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           N+  I+M+Y+    L E +   G L H+LV    +Q+ E L  LH  N IH D+K
Sbjct: 224 NDIHILMEYMHTGSLQEYIARTGPLHHELVKAYAKQILEGLEFLHSKNIIHQDLK 278


>U53336-8|AAA96180.2|  326|Caenorhabditis elegans Aurora/ipl1
           related kinase protein1 protein.
          Length = 326

 Score = 41.1 bits (92), Expect = 0.001
 Identities = 21/71 (29%), Positives = 34/71 (47%), Gaps = 2/71 (2%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKG--ELSHQLVSNIIRQLCEALNDL 35
           HPN + +Y          +++DY    +LF  LQ +   +++  +    +RQL  AL+  
Sbjct: 101 HPNILTLYGYFHDDKRVFVILDYASRGELFNVLQSQPGHKVNEVIAGRFVRQLANALHYC 160

Query: 34  HKHNFIHNDIK 2
           H    IH DIK
Sbjct: 161 HSKGVIHRDIK 171


>AF071206-1|AAC70944.1|  326|Caenorhabditis elegans
           aurora/Ipl1-related protein kinase1 protein.
          Length = 326

 Score = 41.1 bits (92), Expect = 0.001
 Identities = 21/71 (29%), Positives = 34/71 (47%), Gaps = 2/71 (2%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKG--ELSHQLVSNIIRQLCEALNDL 35
           HPN + +Y          +++DY    +LF  LQ +   +++  +    +RQL  AL+  
Sbjct: 101 HPNILTLYGYFHDDKRVFVILDYASRGELFNVLQSQPGHKVNEVIAGRFVRQLANALHYC 160

Query: 34  HKHNFIHNDIK 2
           H    IH DIK
Sbjct: 161 HSKGVIHRDIK 171


>AF039037-1|AAO21431.1|  312|Caenorhabditis elegans Hypothetical
           protein R02C2.1 protein.
          Length = 312

 Score = 41.1 bits (92), Expect = 0.001
 Identities = 23/81 (28%), Positives = 42/81 (51%), Gaps = 2/81 (2%)
 Frame = -3

Query: 238 EIKVHQLMND--HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNII 65
           E K+H+ ++   H N I++           +VM+Y D  DLF+ L+ + + S +   +  
Sbjct: 66  EYKIHRRLSKIGHENVIQMMKMIETPKFYSLVMEYADGGDLFDELKEQEKFSRKDAHSYF 125

Query: 64  RQLCEALNDLHKHNFIHNDIK 2
           +QL + L  +H+   +H DIK
Sbjct: 126 KQLIKGLKFIHEQGIVHRDIK 146


>U55363-8|AAA97966.1|  829|Caenorhabditis elegans Germinal center
           kinase family protein2 protein.
          Length = 829

 Score = 40.7 bits (91), Expect = 0.001
 Identities = 26/87 (29%), Positives = 41/87 (47%), Gaps = 1/87 (1%)
 Frame = -3

Query: 259 GANFNVDEIKVHQLMN-DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQ 83
           G NF V + ++  +    HPN I  + ++   +   IVM+Y     L +   + G LS  
Sbjct: 51  GDNFAVIQQEIMVIRECSHPNIIAYFGSYIRRDRLWIVMEYCGGGSLQDIYHLTGPLSEL 110

Query: 82  LVSNIIRQLCEALNDLHKHNFIHNDIK 2
            ++ + R+    LN LH    IH DIK
Sbjct: 111 QIAFVCRETLRGLNYLHNMGKIHRDIK 137


>AF125956-9|AAK68289.1|  318|Caenorhabditis elegans Hypothetical
           protein DC2.7b protein.
          Length = 318

 Score = 40.7 bits (91), Expect = 0.001
 Identities = 17/51 (33%), Positives = 28/51 (54%)
 Frame = -3

Query: 154 IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           ++ +Y D  DLF+ L+ +GE   +      +QL   L  +H+H  +H DIK
Sbjct: 100 LLKEYADGGDLFKKLETEGEQYSENAQCFFKQLISGLKFIHEHEIVHRDIK 150


>AF125956-8|AAD14728.2|  678|Caenorhabditis elegans Hypothetical
           protein DC2.7a protein.
          Length = 678

 Score = 40.7 bits (91), Expect = 0.001
 Identities = 17/51 (33%), Positives = 28/51 (54%)
 Frame = -3

Query: 154 IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           ++ +Y D  DLF+ L+ +GE   +      +QL   L  +H+H  +H DIK
Sbjct: 100 LLKEYADGGDLFKKLETEGEQYSENAQCFFKQLISGLKFIHEHEIVHRDIK 150



 Score = 36.3 bits (80), Expect = 0.026
 Identities = 18/69 (26%), Positives = 29/69 (42%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           H N I+         +  ++M+Y D  DLF+ +  +  L+        +QL   L  +H 
Sbjct: 392 HENVIRFLSIRTMPEHYFLIMEYADGGDLFDKISSEYRLTSSQAHGYFKQLIAGLRYIHS 451

Query: 28  HNFIHNDIK 2
               H DIK
Sbjct: 452 KGVTHRDIK 460


>AF125956-7|AAX55694.1|  657|Caenorhabditis elegans Hypothetical
           protein DC2.7c protein.
          Length = 657

 Score = 40.7 bits (91), Expect = 0.001
 Identities = 17/51 (33%), Positives = 28/51 (54%)
 Frame = -3

Query: 154 IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           ++ +Y D  DLF+ L+ +GE   +      +QL   L  +H+H  +H DIK
Sbjct: 100 LLKEYADGGDLFKKLETEGEQYSENAQCFFKQLISGLKFIHEHEIVHRDIK 150



 Score = 36.3 bits (80), Expect = 0.026
 Identities = 18/69 (26%), Positives = 29/69 (42%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           H N I+         +  ++M+Y D  DLF+ +  +  L+        +QL   L  +H 
Sbjct: 392 HENVIRFLSIRTMPEHYFLIMEYADGGDLFDKISSEYRLTSSQAHGYFKQLIAGLRYIHS 451

Query: 28  HNFIHNDIK 2
               H DIK
Sbjct: 452 KGVTHRDIK 460


>Z73899-13|CAM35841.1| 6629|Caenorhabditis elegans Hypothetical
            protein ZK617.1c protein.
          Length = 6629

 Score = 40.3 bits (90), Expect = 0.002
 Identities = 17/70 (24%), Positives = 39/70 (55%), Gaps = 1/70 (1%)
 Frame = -3

Query: 208  HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIK-GELSHQLVSNIIRQLCEALNDLH 32
            HP  + ++      N  V++ +++   +LFE +  +  ++S       +RQ+C+ L  +H
Sbjct: 5786 HPTLVNLHDAFEDDNEMVMIYEFMSGGELFEKVADEHNKMSEDEAVEYMRQVCKGLCHMH 5845

Query: 31   KHNFIHNDIK 2
            ++N++H D+K
Sbjct: 5846 ENNYVHLDLK 5855


>Z73899-11|CAA98082.2| 7158|Caenorhabditis elegans Hypothetical
            protein ZK617.1b protein.
          Length = 7158

 Score = 40.3 bits (90), Expect = 0.002
 Identities = 17/70 (24%), Positives = 39/70 (55%), Gaps = 1/70 (1%)
 Frame = -3

Query: 208  HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIK-GELSHQLVSNIIRQLCEALNDLH 32
            HP  + ++      N  V++ +++   +LFE +  +  ++S       +RQ+C+ L  +H
Sbjct: 6315 HPTLVNLHDAFEDDNEMVMIYEFMSGGELFEKVADEHNKMSEDEAVEYMRQVCKGLCHMH 6374

Query: 31   KHNFIHNDIK 2
            ++N++H D+K
Sbjct: 6375 ENNYVHLDLK 6384


>Z73899-10|CAA98081.2| 6839|Caenorhabditis elegans Hypothetical
            protein ZK617.1a protein.
          Length = 6839

 Score = 40.3 bits (90), Expect = 0.002
 Identities = 17/70 (24%), Positives = 39/70 (55%), Gaps = 1/70 (1%)
 Frame = -3

Query: 208  HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIK-GELSHQLVSNIIRQLCEALNDLH 32
            HP  + ++      N  V++ +++   +LFE +  +  ++S       +RQ+C+ L  +H
Sbjct: 5996 HPTLVNLHDAFEDDNEMVMIYEFMSGGELFEKVADEHNKMSEDEAVEYMRQVCKGLCHMH 6055

Query: 31   KHNFIHNDIK 2
            ++N++H D+K
Sbjct: 6056 ENNYVHLDLK 6065


>Z73897-6|CAM35838.1| 6629|Caenorhabditis elegans Hypothetical protein
            ZK617.1c protein.
          Length = 6629

 Score = 40.3 bits (90), Expect = 0.002
 Identities = 17/70 (24%), Positives = 39/70 (55%), Gaps = 1/70 (1%)
 Frame = -3

Query: 208  HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIK-GELSHQLVSNIIRQLCEALNDLH 32
            HP  + ++      N  V++ +++   +LFE +  +  ++S       +RQ+C+ L  +H
Sbjct: 5786 HPTLVNLHDAFEDDNEMVMIYEFMSGGELFEKVADEHNKMSEDEAVEYMRQVCKGLCHMH 5845

Query: 31   KHNFIHNDIK 2
            ++N++H D+K
Sbjct: 5846 ENNYVHLDLK 5855


>Z73897-5|CAA98065.2| 7158|Caenorhabditis elegans Hypothetical protein
            ZK617.1b protein.
          Length = 7158

 Score = 40.3 bits (90), Expect = 0.002
 Identities = 17/70 (24%), Positives = 39/70 (55%), Gaps = 1/70 (1%)
 Frame = -3

Query: 208  HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIK-GELSHQLVSNIIRQLCEALNDLH 32
            HP  + ++      N  V++ +++   +LFE +  +  ++S       +RQ+C+ L  +H
Sbjct: 6315 HPTLVNLHDAFEDDNEMVMIYEFMSGGELFEKVADEHNKMSEDEAVEYMRQVCKGLCHMH 6374

Query: 31   KHNFIHNDIK 2
            ++N++H D+K
Sbjct: 6375 ENNYVHLDLK 6384


>Z73897-4|CAA98064.2| 6839|Caenorhabditis elegans Hypothetical protein
            ZK617.1a protein.
          Length = 6839

 Score = 40.3 bits (90), Expect = 0.002
 Identities = 17/70 (24%), Positives = 39/70 (55%), Gaps = 1/70 (1%)
 Frame = -3

Query: 208  HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIK-GELSHQLVSNIIRQLCEALNDLH 32
            HP  + ++      N  V++ +++   +LFE +  +  ++S       +RQ+C+ L  +H
Sbjct: 5996 HPTLVNLHDAFEDDNEMVMIYEFMSGGELFEKVADEHNKMSEDEAVEYMRQVCKGLCHMH 6055

Query: 31   KHNFIHNDIK 2
            ++N++H D+K
Sbjct: 6056 ENNYVHLDLK 6065


>X15423-1|CAA33463.1| 6048|Caenorhabditis elegans twitchin protein.
          Length = 6048

 Score = 40.3 bits (90), Expect = 0.002
 Identities = 17/70 (24%), Positives = 39/70 (55%), Gaps = 1/70 (1%)
 Frame = -3

Query: 208  HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIK-GELSHQLVSNIIRQLCEALNDLH 32
            HP  + ++      N  V++ +++   +LFE +  +  ++S       +RQ+C+ L  +H
Sbjct: 5205 HPTLVNLHDAFEDDNEMVMIYEFMSGGELFEKVADEHNKMSEDEAVEYMRQVCKGLCHMH 5264

Query: 31   KHNFIHNDIK 2
            ++N++H D+K
Sbjct: 5265 ENNYVHLDLK 5274


>AL110501-9|CAB54507.2|  802|Caenorhabditis elegans Hypothetical
           protein Y79H2A.11 protein.
          Length = 802

 Score = 39.5 bits (88), Expect = 0.003
 Identities = 24/97 (24%), Positives = 53/97 (54%), Gaps = 2/97 (2%)
 Frame = -3

Query: 286 QIVFAENNFGANFNVD-EIKVHQLMNDHPNFIKIYFNHGFINNQVIV-MDYIDCPDLFET 113
           +++  EN  G    ++ E+ + Q + DH   +++Y +H F+++   + ++ I+  DLFE 
Sbjct: 512 KVIARENVIGKEHLIEMELAILQKI-DHTFIVQLY-DHWFVDDSYYLSLELIEMGDLFEH 569

Query: 112 LQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           L+I   +  +    ++  L +AL  +H+   +H D+K
Sbjct: 570 LRIVRRVPERDAVRMMTCLGQALEYIHELGIVHRDVK 606


>AL033514-40|CAD36501.1|  802|Caenorhabditis elegans Hypothetical
           protein Y79H2A.11 protein.
          Length = 802

 Score = 39.5 bits (88), Expect = 0.003
 Identities = 24/97 (24%), Positives = 53/97 (54%), Gaps = 2/97 (2%)
 Frame = -3

Query: 286 QIVFAENNFGANFNVD-EIKVHQLMNDHPNFIKIYFNHGFINNQVIV-MDYIDCPDLFET 113
           +++  EN  G    ++ E+ + Q + DH   +++Y +H F+++   + ++ I+  DLFE 
Sbjct: 512 KVIARENVIGKEHLIEMELAILQKI-DHTFIVQLY-DHWFVDDSYYLSLELIEMGDLFEH 569

Query: 112 LQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           L+I   +  +    ++  L +AL  +H+   +H D+K
Sbjct: 570 LRIVRRVPERDAVRMMTCLGQALEYIHELGIVHRDVK 606


>AJ319870-1|CAC67459.1|  802|Caenorhabditis elegans ZYG-8 protein
           protein.
          Length = 802

 Score = 39.5 bits (88), Expect = 0.003
 Identities = 24/97 (24%), Positives = 53/97 (54%), Gaps = 2/97 (2%)
 Frame = -3

Query: 286 QIVFAENNFGANFNVD-EIKVHQLMNDHPNFIKIYFNHGFINNQVIV-MDYIDCPDLFET 113
           +++  EN  G    ++ E+ + Q + DH   +++Y +H F+++   + ++ I+  DLFE 
Sbjct: 512 KVIARENVIGKEHLIEMELAILQKI-DHTFIVQLY-DHWFVDDSYYLSLELIEMGDLFEH 569

Query: 112 LQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           L+I   +  +    ++  L +AL  +H+   +H D+K
Sbjct: 570 LRIVRRVPERDAVRMMTCLGQALEYIHELGIVHRDVK 606


>AF039037-2|AAO21432.1|  324|Caenorhabditis elegans Hypothetical
           protein R02C2.6 protein.
          Length = 324

 Score = 39.1 bits (87), Expect = 0.004
 Identities = 20/69 (28%), Positives = 30/69 (43%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           H N I ++       N  +++ Y D  DLFE +   G L         +QL + L  +H+
Sbjct: 78  HLNMIHLFEIRTNPENYQLILSYADGGDLFEKINQHGGLGSDEAHRYFKQLIDGLRFIHE 137

Query: 28  HNFIHNDIK 2
               H DIK
Sbjct: 138 EGVTHRDIK 146


>Z74029-5|CAA98433.2|  520|Caenorhabditis elegans Hypothetical
           protein C45B11.1b protein.
          Length = 520

 Score = 38.7 bits (86), Expect = 0.005
 Identities = 19/69 (27%), Positives = 37/69 (53%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN ++ + +H   +   +VM++++   L + +     ++   ++ I RQ+  AL+ LH 
Sbjct: 283 HPNIVRFFSSHLVDDELWVVMEFMEGGSLTDIVTAT-RMTEPQIATISRQVLGALDFLHA 341

Query: 28  HNFIHNDIK 2
              IH DIK
Sbjct: 342 RKVIHRDIK 350


>Z74029-4|CAA98429.2|  522|Caenorhabditis elegans Hypothetical
           protein C45B11.1a protein.
          Length = 522

 Score = 38.7 bits (86), Expect = 0.005
 Identities = 19/69 (27%), Positives = 37/69 (53%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN ++ + +H   +   +VM++++   L + +     ++   ++ I RQ+  AL+ LH 
Sbjct: 285 HPNIVRFFSSHLVDDELWVVMEFMEGGSLTDIVTAT-RMTEPQIATISRQVLGALDFLHA 343

Query: 28  HNFIHNDIK 2
              IH DIK
Sbjct: 344 RKVIHRDIK 352


>DQ523831-1|ABF71876.1|  522|Caenorhabditis elegans P21-activated
           kinase PAK-2 protein.
          Length = 522

 Score = 38.7 bits (86), Expect = 0.005
 Identities = 19/69 (27%), Positives = 37/69 (53%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN ++ + +H   +   +VM++++   L + +     ++   ++ I RQ+  AL+ LH 
Sbjct: 285 HPNIVRFFSSHLVDDELWVVMEFMEGGSLTDIVTAT-RMTEPQIATISRQVLGALDFLHA 343

Query: 28  HNFIHNDIK 2
              IH DIK
Sbjct: 344 RKVIHRDIK 352


>AF100655-2|AAK68684.2|  366|Caenorhabditis elegans Map kinase
           activated protein kinaseprotein 2, isoform b protein.
          Length = 366

 Score = 38.7 bits (86), Expect = 0.005
 Identities = 17/85 (20%), Positives = 49/85 (57%), Gaps = 6/85 (7%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIY--FNHGF--INNQVIVMDYIDCPDLFETLQIKGE--LSHQLV 77
           E+++H + + H + + ++  + + +  ++  ++VM+ +   +LF  +Q +G+   + +  
Sbjct: 53  EVELHVMASGHGHVVSVHDVYKNSYNGVDCLLVVMENMKGGELFNRIQERGQKAFTEREA 112

Query: 76  SNIIRQLCEALNDLHKHNFIHNDIK 2
           + I+ ++C A+  LH+ +  H D+K
Sbjct: 113 AGIVNEICSAVAHLHRMSIAHRDLK 137


>AF100655-1|AAC68944.1|  443|Caenorhabditis elegans Map kinase
           activated protein kinaseprotein 2, isoform a protein.
          Length = 443

 Score = 38.7 bits (86), Expect = 0.005
 Identities = 17/85 (20%), Positives = 49/85 (57%), Gaps = 6/85 (7%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIY--FNHGF--INNQVIVMDYIDCPDLFETLQIKGE--LSHQLV 77
           E+++H + + H + + ++  + + +  ++  ++VM+ +   +LF  +Q +G+   + +  
Sbjct: 130 EVELHVMASGHGHVVSVHDVYKNSYNGVDCLLVVMENMKGGELFNRIQERGQKAFTEREA 189

Query: 76  SNIIRQLCEALNDLHKHNFIHNDIK 2
           + I+ ++C A+  LH+ +  H D+K
Sbjct: 190 AGIVNEICSAVAHLHRMSIAHRDLK 214


>AC025716-18|AAT81178.1|  998|Caenorhabditis elegans Hypothetical
           protein Y39G10AR.3 protein.
          Length = 998

 Score = 38.7 bits (86), Expect = 0.005
 Identities = 20/71 (28%), Positives = 39/71 (54%), Gaps = 1/71 (1%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETL-QIKGELSHQLVSNIIRQLCEALNDL 35
           +HPN I  Y +       +I M+Y D   L + L + +  L  + + +++ Q+C A+  L
Sbjct: 226 EHPNIIAYYDSFEEEGVLMIEMEYADGGTLAQMLSRTQNLLDEEQIGDMMIQMCSAVAYL 285

Query: 34  HKHNFIHNDIK 2
           H+++ +H D+K
Sbjct: 286 HENSVLHRDLK 296


>AC024801-4|AAF59648.4|  485|Caenorhabditis elegans Hypothetical
           protein Y50D7A.3a protein.
          Length = 485

 Score = 38.3 bits (85), Expect = 0.006
 Identities = 17/81 (20%), Positives = 42/81 (51%)
 Frame = -3

Query: 244 VDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNII 65
           + E+++ + ++ HP+ IKI+  +   +    V +     +LF+ L     +S +    ++
Sbjct: 82  ISEVEILRQLSGHPSIIKIHDFYQTPSFLFAVFEMAPRGELFDVLNSTVTVSEKRARRLM 141

Query: 64  RQLCEALNDLHKHNFIHNDIK 2
           +QL + +  +H  + +H D+K
Sbjct: 142 KQLFDGVEYMHARDIVHRDLK 162


>AY733040-1|AAW57534.1| 1425|Caenorhabditis elegans death-associated
           protein kinase protein.
          Length = 1425

 Score = 37.5 bits (83), Expect = 0.011
 Identities = 19/79 (24%), Positives = 43/79 (54%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E++V Q +  + N ++++  +   ++ +IV++ +   +LF+ +  K  L     +  I+Q
Sbjct: 79  EVRVLQKIRGNSNVVELHAVYETASDVIIVLELVSGGELFDHVCAKECLDEVEAAAFIKQ 138

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  A+  LH  + +H DIK
Sbjct: 139 ILLAVRHLHSLHIVHLDIK 157


>AF043701-1|AAK18971.2| 1425|Caenorhabditis elegans Dap
           (death-associated protein)kinase homolog protein 1
           protein.
          Length = 1425

 Score = 37.5 bits (83), Expect = 0.011
 Identities = 19/79 (24%), Positives = 43/79 (54%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E++V Q +  + N ++++  +   ++ +IV++ +   +LF+ +  K  L     +  I+Q
Sbjct: 79  EVRVLQKIRGNSNVVELHAVYETASDVIIVLELVSGGELFDHVCAKECLDEVEAAAFIKQ 138

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  A+  LH  + +H DIK
Sbjct: 139 ILLAVRHLHSLHIVHLDIK 157


>Z70279-14|CAC42329.1|  302|Caenorhabditis elegans Hypothetical
           protein K11E8.1l protein.
          Length = 302

 Score = 37.1 bits (82), Expect = 0.015
 Identities = 17/69 (24%), Positives = 36/69 (52%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN ++++ +    +   +V D +   +LFE +  +   S    S+ I+Q+ E++   H 
Sbjct: 68  HPNIVRLHDSIQEESFHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESIAYCHS 127

Query: 28  HNFIHNDIK 2
           +  +H D+K
Sbjct: 128 NGIVHRDLK 136


>Z70279-13|CAC42328.1|  302|Caenorhabditis elegans Hypothetical
           protein K11E8.1k protein.
          Length = 302

 Score = 37.1 bits (82), Expect = 0.015
 Identities = 17/69 (24%), Positives = 36/69 (52%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN ++++ +    +   +V D +   +LFE +  +   S    S+ I+Q+ E++   H 
Sbjct: 68  HPNIVRLHDSIQEESFHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESIAYCHS 127

Query: 28  HNFIHNDIK 2
           +  +H D+K
Sbjct: 128 NGIVHRDLK 136


>Z70279-12|CAC42322.1|  350|Caenorhabditis elegans Hypothetical
           protein K11E8.1i protein.
          Length = 350

 Score = 37.1 bits (82), Expect = 0.015
 Identities = 17/69 (24%), Positives = 36/69 (52%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN ++++ +    +   +V D +   +LFE +  +   S    S+ I+Q+ E++   H 
Sbjct: 68  HPNIVRLHDSIQEESFHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESIAYCHS 127

Query: 28  HNFIHNDIK 2
           +  +H D+K
Sbjct: 128 NGIVHRDLK 136


>Z70279-11|CAC42324.1|  571|Caenorhabditis elegans Hypothetical
           protein K11E8.1h protein.
          Length = 571

 Score = 37.1 bits (82), Expect = 0.015
 Identities = 17/69 (24%), Positives = 36/69 (52%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN ++++ +    +   +V D +   +LFE +  +   S    S+ I+Q+ E++   H 
Sbjct: 68  HPNIVRLHDSIQEESFHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESIAYCHS 127

Query: 28  HNFIHNDIK 2
           +  +H D+K
Sbjct: 128 NGIVHRDLK 136


>Z70279-10|CAC42323.1|  520|Caenorhabditis elegans Hypothetical
           protein K11E8.1g protein.
          Length = 520

 Score = 37.1 bits (82), Expect = 0.015
 Identities = 17/69 (24%), Positives = 36/69 (52%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN ++++ +    +   +V D +   +LFE +  +   S    S+ I+Q+ E++   H 
Sbjct: 68  HPNIVRLHDSIQEESFHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESIAYCHS 127

Query: 28  HNFIHNDIK 2
           +  +H D+K
Sbjct: 128 NGIVHRDLK 136


>Z70279-9|CAC42327.1|  518|Caenorhabditis elegans Hypothetical
           protein K11E8.1f protein.
          Length = 518

 Score = 37.1 bits (82), Expect = 0.015
 Identities = 17/69 (24%), Positives = 36/69 (52%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN ++++ +    +   +V D +   +LFE +  +   S    S+ I+Q+ E++   H 
Sbjct: 68  HPNIVRLHDSIQEESFHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESIAYCHS 127

Query: 28  HNFIHNDIK 2
           +  +H D+K
Sbjct: 128 NGIVHRDLK 136


>Z70279-8|CAC42325.1|  533|Caenorhabditis elegans Hypothetical
           protein K11E8.1e protein.
          Length = 533

 Score = 37.1 bits (82), Expect = 0.015
 Identities = 17/69 (24%), Positives = 36/69 (52%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN ++++ +    +   +V D +   +LFE +  +   S    S+ I+Q+ E++   H 
Sbjct: 68  HPNIVRLHDSIQEESFHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESIAYCHS 127

Query: 28  HNFIHNDIK 2
           +  +H D+K
Sbjct: 128 NGIVHRDLK 136


>Z70279-7|CAC42326.1|  482|Caenorhabditis elegans Hypothetical
           protein K11E8.1d protein.
          Length = 482

 Score = 37.1 bits (82), Expect = 0.015
 Identities = 17/69 (24%), Positives = 36/69 (52%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN ++++ +    +   +V D +   +LFE +  +   S    S+ I+Q+ E++   H 
Sbjct: 68  HPNIVRLHDSIQEESFHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESIAYCHS 127

Query: 28  HNFIHNDIK 2
           +  +H D+K
Sbjct: 128 NGIVHRDLK 136


>Z70279-6|CAA94244.2|  720|Caenorhabditis elegans Hypothetical
           protein K11E8.1c protein.
          Length = 720

 Score = 37.1 bits (82), Expect = 0.015
 Identities = 17/69 (24%), Positives = 36/69 (52%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN ++++ +    +   +V D +   +LFE +  +   S    S+ I+Q+ E++   H 
Sbjct: 68  HPNIVRLHDSIQEESFHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESIAYCHS 127

Query: 28  HNFIHNDIK 2
           +  +H D+K
Sbjct: 128 NGIVHRDLK 136


>Z70279-4|CAA94242.2|  559|Caenorhabditis elegans Hypothetical
           protein K11E8.1a protein.
          Length = 559

 Score = 37.1 bits (82), Expect = 0.015
 Identities = 17/69 (24%), Positives = 36/69 (52%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN ++++ +    +   +V D +   +LFE +  +   S    S+ I+Q+ E++   H 
Sbjct: 68  HPNIVRLHDSIQEESFHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESIAYCHS 127

Query: 28  HNFIHNDIK 2
           +  +H D+K
Sbjct: 128 NGIVHRDLK 136


>Z34989-1|CAA84441.1|  404|Caenorhabditis elegans Ndr protein kinase
           protein.
          Length = 404

 Score = 37.1 bits (82), Expect = 0.015
 Identities = 18/65 (27%), Positives = 33/65 (50%)
 Frame = -3

Query: 196 IKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFI 17
           +K+Y++    +N  +VM+++   D+   L  K  L+ +     I +   A+  +H   FI
Sbjct: 90  VKMYYSFQDYSNLYLVMEFLPGGDMMTLLIKKDTLTEEATQFYIAEAALAIQFIHSLGFI 149

Query: 16  HNDIK 2
           H DIK
Sbjct: 150 HRDIK 154


>U41016-7|ABC71807.1|  476|Caenorhabditis elegans Sensory axon
           guidance protein 1,isoform a protein.
          Length = 476

 Score = 37.1 bits (82), Expect = 0.015
 Identities = 18/65 (27%), Positives = 33/65 (50%)
 Frame = -3

Query: 196 IKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFI 17
           +K+Y++    +N  +VM+++   D+   L  K  L+ +     I +   A+  +H   FI
Sbjct: 148 VKMYYSFQDYSNLYLVMEFLPGGDMMTLLIKKDTLTEEATQFYIAEAALAIQFIHSLGFI 207

Query: 16  HNDIK 2
           H DIK
Sbjct: 208 HRDIK 212


>U41016-6|ABC71808.1|  474|Caenorhabditis elegans Sensory axon
           guidance protein 1,isoform b protein.
          Length = 474

 Score = 37.1 bits (82), Expect = 0.015
 Identities = 18/65 (27%), Positives = 33/65 (50%)
 Frame = -3

Query: 196 IKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFI 17
           +K+Y++    +N  +VM+++   D+   L  K  L+ +     I +   A+  +H   FI
Sbjct: 148 VKMYYSFQDYSNLYLVMEFLPGGDMMTLLIKKDTLTEEATQFYIAEAALAIQFIHSLGFI 207

Query: 16  HNDIK 2
           H DIK
Sbjct: 208 HRDIK 212


>AL023841-12|CAC42367.1|  302|Caenorhabditis elegans Hypothetical
           protein K11E8.1l protein.
          Length = 302

 Score = 37.1 bits (82), Expect = 0.015
 Identities = 17/69 (24%), Positives = 36/69 (52%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN ++++ +    +   +V D +   +LFE +  +   S    S+ I+Q+ E++   H 
Sbjct: 68  HPNIVRLHDSIQEESFHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESIAYCHS 127

Query: 28  HNFIHNDIK 2
           +  +H D+K
Sbjct: 128 NGIVHRDLK 136


>AL023841-11|CAC42366.1|  302|Caenorhabditis elegans Hypothetical
           protein K11E8.1k protein.
          Length = 302

 Score = 37.1 bits (82), Expect = 0.015
 Identities = 17/69 (24%), Positives = 36/69 (52%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN ++++ +    +   +V D +   +LFE +  +   S    S+ I+Q+ E++   H 
Sbjct: 68  HPNIVRLHDSIQEESFHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESIAYCHS 127

Query: 28  HNFIHNDIK 2
           +  +H D+K
Sbjct: 128 NGIVHRDLK 136


>AL023841-10|CAC42360.1|  350|Caenorhabditis elegans Hypothetical
           protein K11E8.1i protein.
          Length = 350

 Score = 37.1 bits (82), Expect = 0.015
 Identities = 17/69 (24%), Positives = 36/69 (52%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN ++++ +    +   +V D +   +LFE +  +   S    S+ I+Q+ E++   H 
Sbjct: 68  HPNIVRLHDSIQEESFHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESIAYCHS 127

Query: 28  HNFIHNDIK 2
           +  +H D+K
Sbjct: 128 NGIVHRDLK 136


>AL023841-9|CAC42362.1|  571|Caenorhabditis elegans Hypothetical
           protein K11E8.1h protein.
          Length = 571

 Score = 37.1 bits (82), Expect = 0.015
 Identities = 17/69 (24%), Positives = 36/69 (52%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN ++++ +    +   +V D +   +LFE +  +   S    S+ I+Q+ E++   H 
Sbjct: 68  HPNIVRLHDSIQEESFHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESIAYCHS 127

Query: 28  HNFIHNDIK 2
           +  +H D+K
Sbjct: 128 NGIVHRDLK 136


>AL023841-8|CAC42361.1|  520|Caenorhabditis elegans Hypothetical
           protein K11E8.1g protein.
          Length = 520

 Score = 37.1 bits (82), Expect = 0.015
 Identities = 17/69 (24%), Positives = 36/69 (52%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN ++++ +    +   +V D +   +LFE +  +   S    S+ I+Q+ E++   H 
Sbjct: 68  HPNIVRLHDSIQEESFHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESIAYCHS 127

Query: 28  HNFIHNDIK 2
           +  +H D+K
Sbjct: 128 NGIVHRDLK 136


>AL023841-7|CAC42365.1|  518|Caenorhabditis elegans Hypothetical
           protein K11E8.1f protein.
          Length = 518

 Score = 37.1 bits (82), Expect = 0.015
 Identities = 17/69 (24%), Positives = 36/69 (52%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN ++++ +    +   +V D +   +LFE +  +   S    S+ I+Q+ E++   H 
Sbjct: 68  HPNIVRLHDSIQEESFHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESIAYCHS 127

Query: 28  HNFIHNDIK 2
           +  +H D+K
Sbjct: 128 NGIVHRDLK 136


>AL023841-6|CAC42363.1|  533|Caenorhabditis elegans Hypothetical
           protein K11E8.1e protein.
          Length = 533

 Score = 37.1 bits (82), Expect = 0.015
 Identities = 17/69 (24%), Positives = 36/69 (52%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN ++++ +    +   +V D +   +LFE +  +   S    S+ I+Q+ E++   H 
Sbjct: 68  HPNIVRLHDSIQEESFHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESIAYCHS 127

Query: 28  HNFIHNDIK 2
           +  +H D+K
Sbjct: 128 NGIVHRDLK 136


>AL023841-5|CAC42364.1|  482|Caenorhabditis elegans Hypothetical
           protein K11E8.1d protein.
          Length = 482

 Score = 37.1 bits (82), Expect = 0.015
 Identities = 17/69 (24%), Positives = 36/69 (52%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN ++++ +    +   +V D +   +LFE +  +   S    S+ I+Q+ E++   H 
Sbjct: 68  HPNIVRLHDSIQEESFHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESIAYCHS 127

Query: 28  HNFIHNDIK 2
           +  +H D+K
Sbjct: 128 NGIVHRDLK 136


>AL023841-4|CAC42359.1|  720|Caenorhabditis elegans Hypothetical
           protein K11E8.1c protein.
          Length = 720

 Score = 37.1 bits (82), Expect = 0.015
 Identities = 17/69 (24%), Positives = 36/69 (52%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN ++++ +    +   +V D +   +LFE +  +   S    S+ I+Q+ E++   H 
Sbjct: 68  HPNIVRLHDSIQEESFHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESIAYCHS 127

Query: 28  HNFIHNDIK 2
           +  +H D+K
Sbjct: 128 NGIVHRDLK 136


>AL023841-2|CAC42358.1|  559|Caenorhabditis elegans Hypothetical
           protein K11E8.1a protein.
          Length = 559

 Score = 37.1 bits (82), Expect = 0.015
 Identities = 17/69 (24%), Positives = 36/69 (52%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN ++++ +    +   +V D +   +LFE +  +   S    S+ I+Q+ E++   H 
Sbjct: 68  HPNIVRLHDSIQEESFHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESIAYCHS 127

Query: 28  HNFIHNDIK 2
           +  +H D+K
Sbjct: 128 NGIVHRDLK 136


>AF275634-1|AAF91417.1|  469|Caenorhabditis elegans SAX-1 Ndr
           protein kinase protein.
          Length = 469

 Score = 37.1 bits (82), Expect = 0.015
 Identities = 18/65 (27%), Positives = 33/65 (50%)
 Frame = -3

Query: 196 IKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFI 17
           +K+Y++    +N  +VM+++   D+   L  K  L+ +     I +   A+  +H   FI
Sbjct: 141 VKMYYSFQDYSNLYLVMEFLPGGDMMTLLIKKDTLTEEATQFYIAEAALAIQFIHSLGFI 200

Query: 16  HNDIK 2
           H DIK
Sbjct: 201 HRDIK 205


>AF255956-1|AAF71543.1|  350|Caenorhabditis elegans
           calcium/calmodulin-dependent proteinkinase II isoform H
           protein.
          Length = 350

 Score = 37.1 bits (82), Expect = 0.015
 Identities = 17/69 (24%), Positives = 36/69 (52%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN ++++ +    +   +V D +   +LFE +  +   S    S+ I+Q+ E++   H 
Sbjct: 68  HPNIVRLHDSIQEESFHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESIAYCHS 127

Query: 28  HNFIHNDIK 2
           +  +H D+K
Sbjct: 128 NGIVHRDLK 136


>AF233267-1|AAF63325.1|  302|Caenorhabditis elegans
           calcium/calmodulin-dependent proteinkinase II isoform G
           protein.
          Length = 302

 Score = 37.1 bits (82), Expect = 0.015
 Identities = 17/69 (24%), Positives = 36/69 (52%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN ++++ +    +   +V D +   +LFE +  +   S    S+ I+Q+ E++   H 
Sbjct: 68  HPNIVRLHDSIQEESFHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESIAYCHS 127

Query: 28  HNFIHNDIK 2
           +  +H D+K
Sbjct: 128 NGIVHRDLK 136


>AF233266-1|AAF63324.1|  302|Caenorhabditis elegans
           calcium/calmodulin-dependent proteinkinase II isoform F
           protein.
          Length = 302

 Score = 37.1 bits (82), Expect = 0.015
 Identities = 17/69 (24%), Positives = 36/69 (52%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN ++++ +    +   +V D +   +LFE +  +   S    S+ I+Q+ E++   H 
Sbjct: 68  HPNIVRLHDSIQEESFHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESIAYCHS 127

Query: 28  HNFIHNDIK 2
           +  +H D+K
Sbjct: 128 NGIVHRDLK 136


>AF233265-1|AAF63323.1|  518|Caenorhabditis elegans
           calcium/calmodulin-dependent proteinkinase II isoform E
           protein.
          Length = 518

 Score = 37.1 bits (82), Expect = 0.015
 Identities = 17/69 (24%), Positives = 36/69 (52%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN ++++ +    +   +V D +   +LFE +  +   S    S+ I+Q+ E++   H 
Sbjct: 68  HPNIVRLHDSIQEESFHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESIAYCHS 127

Query: 28  HNFIHNDIK 2
           +  +H D+K
Sbjct: 128 NGIVHRDLK 136


>AF233264-1|AAF63322.1|  571|Caenorhabditis elegans
           calcium/calmodulin-dependent proteinkinase II isoform D
           protein.
          Length = 571

 Score = 37.1 bits (82), Expect = 0.015
 Identities = 17/69 (24%), Positives = 36/69 (52%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN ++++ +    +   +V D +   +LFE +  +   S    S+ I+Q+ E++   H 
Sbjct: 68  HPNIVRLHDSIQEESFHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESIAYCHS 127

Query: 28  HNFIHNDIK 2
           +  +H D+K
Sbjct: 128 NGIVHRDLK 136


>AF233263-1|AAF63321.1|  533|Caenorhabditis elegans
           calcium/calmodulin-dependent proteinkinase II isoform C
           protein.
          Length = 533

 Score = 37.1 bits (82), Expect = 0.015
 Identities = 17/69 (24%), Positives = 36/69 (52%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN ++++ +    +   +V D +   +LFE +  +   S    S+ I+Q+ E++   H 
Sbjct: 68  HPNIVRLHDSIQEESFHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESIAYCHS 127

Query: 28  HNFIHNDIK 2
           +  +H D+K
Sbjct: 128 NGIVHRDLK 136


>AF233262-1|AAF63320.1|  520|Caenorhabditis elegans
           calcium/calmodulin-dependent proteinkinase II isoform B
           protein.
          Length = 520

 Score = 37.1 bits (82), Expect = 0.015
 Identities = 17/69 (24%), Positives = 36/69 (52%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN ++++ +    +   +V D +   +LFE +  +   S    S+ I+Q+ E++   H 
Sbjct: 68  HPNIVRLHDSIQEESFHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESIAYCHS 127

Query: 28  HNFIHNDIK 2
           +  +H D+K
Sbjct: 128 NGIVHRDLK 136


>AF180735-1|AAD53949.1|  482|Caenorhabditis elegans
           calcium/calmodulin dependent proteinkinase II protein.
          Length = 482

 Score = 37.1 bits (82), Expect = 0.015
 Identities = 17/69 (24%), Positives = 36/69 (52%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN ++++ +    +   +V D +   +LFE +  +   S    S+ I+Q+ E++   H 
Sbjct: 68  HPNIVRLHDSIQEESFHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESIAYCHS 127

Query: 28  HNFIHNDIK 2
           +  +H D+K
Sbjct: 128 NGIVHRDLK 136


>U58726-7|AAP13770.1|  562|Caenorhabditis elegans Amp-activated
           kinase protein 2,isoform c protein.
          Length = 562

 Score = 36.7 bits (81), Expect = 0.020
 Identities = 15/69 (21%), Positives = 35/69 (50%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HP+ I++Y      ++  ++M+++   +LF+ +   G L         +Q+   ++  H+
Sbjct: 82  HPHIIRLYQVISTPSDIFMIMEHVSGGELFDYIVKHGRLKTAEARRFFQQIISGVDYCHR 141

Query: 28  HNFIHNDIK 2
           H  +H D+K
Sbjct: 142 HMVVHRDLK 150


>U58726-6|AAM69095.1|  624|Caenorhabditis elegans Amp-activated
           kinase protein 2,isoform a protein.
          Length = 624

 Score = 36.7 bits (81), Expect = 0.020
 Identities = 15/69 (21%), Positives = 35/69 (50%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HP+ I++Y      ++  ++M+++   +LF+ +   G L         +Q+   ++  H+
Sbjct: 144 HPHIIRLYQVISTPSDIFMIMEHVSGGELFDYIVKHGRLKTAEARRFFQQIISGVDYCHR 203

Query: 28  HNFIHNDIK 2
           H  +H D+K
Sbjct: 204 HMVVHRDLK 212


>U58726-5|AAM69096.1|  626|Caenorhabditis elegans Amp-activated
           kinase protein 2,isoform b protein.
          Length = 626

 Score = 36.7 bits (81), Expect = 0.020
 Identities = 15/69 (21%), Positives = 35/69 (50%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HP+ I++Y      ++  ++M+++   +LF+ +   G L         +Q+   ++  H+
Sbjct: 144 HPHIIRLYQVISTPSDIFMIMEHVSGGELFDYIVKHGRLKTAEARRFFQQIISGVDYCHR 203

Query: 28  HNFIHNDIK 2
           H  +H D+K
Sbjct: 204 HMVVHRDLK 212


>U00034-3|AAL00850.1|  211|Caenorhabditis elegans Pim (mammalian
           oncogene) relatedkinase protein 1, isoform b protein.
          Length = 211

 Score = 36.7 bits (81), Expect = 0.020
 Identities = 22/72 (30%), Positives = 37/72 (51%), Gaps = 2/72 (2%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIVMDY-IDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDL 35
           D P  IKI          +IVM+   +C DLF+ + + G L+  +   I +Q+   + ++
Sbjct: 94  DIPGVIKILDWFANSKGFLIVMERPANCMDLFDMVSVHGPLNEDMGKFIFKQVITTVFNM 153

Query: 34  H-KHNFIHNDIK 2
           + KH  +H DIK
Sbjct: 154 YSKHGLLHRDIK 165


>U00034-2|AAM15548.1|  378|Caenorhabditis elegans Pim (mammalian
           oncogene) relatedkinase protein 1, isoform c protein.
          Length = 378

 Score = 36.7 bits (81), Expect = 0.020
 Identities = 22/72 (30%), Positives = 37/72 (51%), Gaps = 2/72 (2%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIVMDY-IDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDL 35
           D P  IKI          +IVM+   +C DLF+ + + G L+  +   I +Q+   + ++
Sbjct: 94  DIPGVIKILDWFANSKGFLIVMERPANCMDLFDMVSVHGPLNEDMGKFIFKQVITTVFNM 153

Query: 34  H-KHNFIHNDIK 2
           + KH  +H DIK
Sbjct: 154 YSKHGLLHRDIK 165


>U00034-1|AAA50639.2|  566|Caenorhabditis elegans Pim (mammalian
           oncogene) relatedkinase protein 1, isoform a protein.
          Length = 566

 Score = 36.7 bits (81), Expect = 0.020
 Identities = 22/72 (30%), Positives = 37/72 (51%), Gaps = 2/72 (2%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIVMDY-IDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDL 35
           D P  IKI          +IVM+   +C DLF+ + + G L+  +   I +Q+   + ++
Sbjct: 94  DIPGVIKILDWFANSKGFLIVMERPANCMDLFDMVSVHGPLNEDMGKFIFKQVITTVFNM 153

Query: 34  H-KHNFIHNDIK 2
           + KH  +H DIK
Sbjct: 154 YSKHGLLHRDIK 165


>AY347273-1|AAR06928.1|  624|Caenorhabditis elegans AMP-activated
           protein kinase alphasubunit 1 protein.
          Length = 624

 Score = 36.7 bits (81), Expect = 0.020
 Identities = 15/69 (21%), Positives = 35/69 (50%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HP+ I++Y      ++  ++M+++   +LF+ +   G L         +Q+   ++  H+
Sbjct: 144 HPHIIRLYQVISTPSDIFMIMEHVSGGELFDYIVKHGRLKTAEARRFFQQIISGVDYCHR 203

Query: 28  HNFIHNDIK 2
           H  +H D+K
Sbjct: 204 HMVVHRDLK 212


>AF125964-5|AAP13765.1|  722|Caenorhabditis elegans Hypothetical
           protein W03G1.6b protein.
          Length = 722

 Score = 36.3 bits (80), Expect = 0.026
 Identities = 18/69 (26%), Positives = 31/69 (44%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           H N  ++Y      +   IVM+Y    ++F+ +  K  L      +  RQL  A+  +H 
Sbjct: 66  HQNICRLYHYIETEDKFFIVMEYCSGGEMFDYIVRKERLEESEARHFFRQLVSAIAFVHS 125

Query: 28  HNFIHNDIK 2
             + H D+K
Sbjct: 126 QGYAHRDLK 134


>AF125964-2|AAD14754.1|  726|Caenorhabditis elegans Hypothetical
           protein W03G1.6a protein.
          Length = 726

 Score = 36.3 bits (80), Expect = 0.026
 Identities = 18/69 (26%), Positives = 31/69 (44%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           H N  ++Y      +   IVM+Y    ++F+ +  K  L      +  RQL  A+  +H 
Sbjct: 66  HQNICRLYHYIETEDKFFIVMEYCSGGEMFDYIVRKERLEESEARHFFRQLVSAIAFVHS 125

Query: 28  HNFIHNDIK 2
             + H D+K
Sbjct: 126 QGYAHRDLK 134


>AF039037-4|AAC48229.3|  311|Caenorhabditis elegans Protein kinase
           protein 34 protein.
          Length = 311

 Score = 36.3 bits (80), Expect = 0.026
 Identities = 20/79 (25%), Positives = 34/79 (43%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI + + +  H N I++           + ++Y D  DL+E +      S +   +  +Q
Sbjct: 73  EITIQESLTGHENVIQVLGKESDAQFCYMFLEYADGGDLYEKITSGCSFSLEEAHSYFKQ 132

Query: 58  LCEALNDLHKHNFIHNDIK 2
           L   L  LH  +  H DIK
Sbjct: 133 LVNGLKFLHCRDVAHRDIK 151


>Z81594-1|CAB04745.1|  908|Caenorhabditis elegans Hypothetical
           protein T20F10.1 protein.
          Length = 908

 Score = 35.5 bits (78), Expect = 0.045
 Identities = 19/70 (27%), Positives = 32/70 (45%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLH 32
           D P  ++++F+         +M+Y+   D+   L  KG     L    I +L  A+  +H
Sbjct: 558 DSPWIVRLFFSFQDDACLYFIMEYVPGGDMMTLLIQKGIFEEDLARFYIAELACAIEYVH 617

Query: 31  KHNFIHNDIK 2
              FIH D+K
Sbjct: 618 NVGFIHRDLK 627


>Z70279-5|CAA94243.3|  137|Caenorhabditis elegans Hypothetical
           protein K11E8.1b protein.
          Length = 137

 Score = 35.5 bits (78), Expect = 0.045
 Identities = 17/69 (24%), Positives = 34/69 (49%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN ++++ +    +   +V D +   +LFE +  +   S    S  I Q+ + +N  H+
Sbjct: 68  HPNIVRLHDSIQEESFHYLVFDLVTGGELFEDIVAREFYSEADASCCIMQILDGVNYCHQ 127

Query: 28  HNFIHNDIK 2
              +H D+K
Sbjct: 128 RGIVHRDMK 136


>AL023841-3|CAC42357.1|  137|Caenorhabditis elegans Hypothetical
           protein K11E8.1b protein.
          Length = 137

 Score = 35.5 bits (78), Expect = 0.045
 Identities = 17/69 (24%), Positives = 34/69 (49%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN ++++ +    +   +V D +   +LFE +  +   S    S  I Q+ + +N  H+
Sbjct: 68  HPNIVRLHDSIQEESFHYLVFDLVTGGELFEDIVAREFYSEADASCCIMQILDGVNYCHQ 127

Query: 28  HNFIHNDIK 2
              +H D+K
Sbjct: 128 RGIVHRDMK 136


>Z99277-6|CAB16484.1|  677|Caenorhabditis elegans Hypothetical
           protein Y53C12A.1 protein.
          Length = 677

 Score = 35.1 bits (77), Expect = 0.060
 Identities = 22/79 (27%), Positives = 35/79 (44%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E + H ++  H N +K Y          I  +  D   L +    K  L    + NI   
Sbjct: 153 EAESHMIIPPHKNLVKFYRAWEETGRLYIQTELCD-QSLLKYCTEKHALPEDEIWNIFVD 211

Query: 58  LCEALNDLHKHNFIHNDIK 2
           L +A++ LH ++ IH+DIK
Sbjct: 212 LLQAVHHLHSNDMIHDDIK 230


>Z83731-4|CAB06021.2|  471|Caenorhabditis elegans Hypothetical
           protein M04C9.5 protein.
          Length = 471

 Score = 35.1 bits (77), Expect = 0.060
 Identities = 23/82 (28%), Positives = 44/82 (53%), Gaps = 3/82 (3%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVI--VMDYIDCPDLFETLQIKGE-LSHQLVSNI 68
           E+K  + +N HPN IK+        N ++  V +++   +L+E ++ +       ++ NI
Sbjct: 57  EVKSLKKLN-HPNIIKL--REVIRENDILYFVFEFMQ-ENLYELMKDRDRYFPESVIRNI 112

Query: 67  IRQLCEALNDLHKHNFIHNDIK 2
           I Q+ + L  +HK+ F H D+K
Sbjct: 113 IYQVLQGLAFMHKNGFFHRDMK 134


>Z83217-5|CAB05684.2| 1565|Caenorhabditis elegans Hypothetical
           protein C10C6.1 protein.
          Length = 1565

 Score = 35.1 bits (77), Expect = 0.060
 Identities = 18/72 (25%), Positives = 34/72 (47%)
 Frame = -3

Query: 217 MNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALND 38
           M D+P  +  Y +        ++M+Y++  D    L+  G L  +LV   + +   A+  
Sbjct: 607 MADNPFVVSFYGSFETRQYLCMLMEYVEGGDCAALLKSAGTLPVELVRLYVAETILAIEY 666

Query: 37  LHKHNFIHNDIK 2
           LH +  +H D+K
Sbjct: 667 LHSYGIVHRDLK 678


>Z81460-3|CAB03829.1| 1228|Caenorhabditis elegans Hypothetical
           protein C04A11.3 protein.
          Length = 1228

 Score = 35.1 bits (77), Expect = 0.060
 Identities = 23/83 (27%), Positives = 39/83 (46%), Gaps = 4/83 (4%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI++      HP  + +Y  + F N   +++++     +   +    EL H L  + IR 
Sbjct: 80  EIEILSECKGHPVMLGLYSTYFFENKLTMLLEFCGGGAVDNIIV---ELGHVLKEDQIRY 136

Query: 58  L----CEALNDLHKHNFIHNDIK 2
           +    C+AL  LH  N IH D+K
Sbjct: 137 IGYYVCDALKWLHSQNVIHRDLK 159


>U63744-1|AAC47308.1|  572|Caenorhabditis elegans p21-activated
           kinase CePAK protein.
          Length = 572

 Score = 35.1 bits (77), Expect = 0.060
 Identities = 20/81 (24%), Positives = 43/81 (53%)
 Frame = -3

Query: 244 VDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNII 65
           ++EI V +  N H N +    ++   +   +VM+Y+    L + +  + ++   +++ + 
Sbjct: 338 INEILVMR-ENKHANIVNYLDSYLVCDELWVVMEYLAGGSLTDVVT-ECQMEDGIIAAVC 395

Query: 64  RQLCEALNDLHKHNFIHNDIK 2
           R++ +AL  LH  + IH DIK
Sbjct: 396 REVLQALEFLHSRHVIHRDIK 416


>U29612-11|AAO61438.1|  523|Caenorhabditis elegans P21-activated
           kinase family protein1, isoform c protein.
          Length = 523

 Score = 35.1 bits (77), Expect = 0.060
 Identities = 20/81 (24%), Positives = 43/81 (53%)
 Frame = -3

Query: 244 VDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNII 65
           ++EI V +  N H N +    ++   +   +VM+Y+    L + +  + ++   +++ + 
Sbjct: 289 INEILVMR-ENKHANIVNYLDSYLVCDELWVVMEYLAGGSLTDVVT-ECQMEDGIIAAVC 346

Query: 64  RQLCEALNDLHKHNFIHNDIK 2
           R++ +AL  LH  + IH DIK
Sbjct: 347 REVLQALEFLHSRHVIHRDIK 367


>U29612-10|AAA68805.2|  572|Caenorhabditis elegans P21-activated
           kinase family protein1, isoform a protein.
          Length = 572

 Score = 35.1 bits (77), Expect = 0.060
 Identities = 20/81 (24%), Positives = 43/81 (53%)
 Frame = -3

Query: 244 VDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNII 65
           ++EI V +  N H N +    ++   +   +VM+Y+    L + +  + ++   +++ + 
Sbjct: 338 INEILVMR-ENKHANIVNYLDSYLVCDELWVVMEYLAGGSLTDVVT-ECQMEDGIIAAVC 395

Query: 64  RQLCEALNDLHKHNFIHNDIK 2
           R++ +AL  LH  + IH DIK
Sbjct: 396 REVLQALEFLHSRHVIHRDIK 416


>U29612-9|AAL65775.1|  569|Caenorhabditis elegans P21-activated
           kinase family protein1, isoform b protein.
          Length = 569

 Score = 35.1 bits (77), Expect = 0.060
 Identities = 20/81 (24%), Positives = 43/81 (53%)
 Frame = -3

Query: 244 VDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNII 65
           ++EI V +  N H N +    ++   +   +VM+Y+    L + +  + ++   +++ + 
Sbjct: 335 INEILVMR-ENKHANIVNYLDSYLVCDELWVVMEYLAGGSLTDVVT-ECQMEDGIIAAVC 392

Query: 64  RQLCEALNDLHKHNFIHNDIK 2
           R++ +AL  LH  + IH DIK
Sbjct: 393 REVLQALEFLHSRHVIHRDIK 413


>D83215-1|BAA11844.1|  569|Caenorhabditis elegans protein kinase
           protein.
          Length = 569

 Score = 35.1 bits (77), Expect = 0.060
 Identities = 20/81 (24%), Positives = 43/81 (53%)
 Frame = -3

Query: 244 VDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNII 65
           ++EI V +  N H N +    ++   +   +VM+Y+    L + +  + ++   +++ + 
Sbjct: 335 INEILVMR-ENKHANIVNYLDSYLVCDELWVVMEYLAGGSLTDVVT-ECQMEDGIIAAVC 392

Query: 64  RQLCEALNDLHKHNFIHNDIK 2
           R++ +AL  LH  + IH DIK
Sbjct: 393 REVLQALEFLHSRHVIHRDIK 413


>AM498742-1|CAM58448.1|  471|Caenorhabditis elegans MAP kinase
           protein.
          Length = 471

 Score = 35.1 bits (77), Expect = 0.060
 Identities = 23/82 (28%), Positives = 44/82 (53%), Gaps = 3/82 (3%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVI--VMDYIDCPDLFETLQIKGE-LSHQLVSNI 68
           E+K  + +N HPN IK+        N ++  V +++   +L+E ++ +       ++ NI
Sbjct: 57  EVKSLKKLN-HPNIIKL--REVIRENDILYFVFEFMQ-ENLYELMKDRDRYFPESVIRNI 112

Query: 67  IRQLCEALNDLHKHNFIHNDIK 2
           I Q+ + L  +HK+ F H D+K
Sbjct: 113 IYQVLQGLAFMHKNGFFHRDMK 134


>AM086627-1|CAJ31105.1| 1565|Caenorhabditis elegans KIN-4 protein
           protein.
          Length = 1565

 Score = 35.1 bits (77), Expect = 0.060
 Identities = 18/72 (25%), Positives = 34/72 (47%)
 Frame = -3

Query: 217 MNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALND 38
           M D+P  +  Y +        ++M+Y++  D    L+  G L  +LV   + +   A+  
Sbjct: 607 MADNPFVVSFYGSFETRQYLCMLMEYVEGGDCAALLKSAGTLPVELVRLYVAETILAIEY 666

Query: 37  LHKHNFIHNDIK 2
           LH +  +H D+K
Sbjct: 667 LHSYGIVHRDLK 678


>AF067607-4|AAF98610.2|  390|Caenorhabditis elegans Hypothetical
           protein C18H7.4 protein.
          Length = 390

 Score = 35.1 bits (77), Expect = 0.060
 Identities = 27/82 (32%), Positives = 44/82 (53%), Gaps = 4/82 (4%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQV---IVMDYIDCPDLFETLQIKGELS-HQLVSN 71
           E +V QL  DHPN +K Y   G+I + V   +V+++ +   + + L+ K E+  ++ V  
Sbjct: 169 EARVMQLY-DHPNIVKFY---GYILDDVPYLLVLEFCNGGSVEDLLRDKPEIKINRRVQY 224

Query: 70  IIRQLCEALNDLHKHNFIHNDI 5
                C  ++ LHK N IH DI
Sbjct: 225 TYMAAC-GMDYLHKKNCIHRDI 245


>Z84574-8|CAE54891.1|  921|Caenorhabditis elegans Hypothetical
           protein F33E2.2b protein.
          Length = 921

 Score = 34.7 bits (76), Expect = 0.079
 Identities = 13/51 (25%), Positives = 30/51 (58%)
 Frame = -3

Query: 154 IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           IVM+Y     L   L+ +  ++ +L +  ++++ + ++ LH++  IH D+K
Sbjct: 198 IVMEYCSKGQLCTVLKSRNTITRELFAQWVKEIADGMHYLHQNKVIHRDLK 248


>Z84574-7|CAB06544.3|  928|Caenorhabditis elegans Hypothetical
           protein F33E2.2a protein.
          Length = 928

 Score = 34.7 bits (76), Expect = 0.079
 Identities = 13/51 (25%), Positives = 30/51 (58%)
 Frame = -3

Query: 154 IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           IVM+Y     L   L+ +  ++ +L +  ++++ + ++ LH++  IH D+K
Sbjct: 198 IVMEYCSKGQLCTVLKSRNTITRELFAQWVKEIADGMHYLHQNKVIHRDLK 248


>Z84574-1|CAE54890.1|  577|Caenorhabditis elegans Hypothetical
           protein F33E2.2c protein.
          Length = 577

 Score = 34.7 bits (76), Expect = 0.079
 Identities = 13/51 (25%), Positives = 30/51 (58%)
 Frame = -3

Query: 154 IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           IVM+Y     L   L+ +  ++ +L +  ++++ + ++ LH++  IH D+K
Sbjct: 198 IVMEYCSKGQLCTVLKSRNTITRELFAQWVKEIADGMHYLHQNKVIHRDLK 248


>Z81140-4|CAJ55247.1|  463|Caenorhabditis elegans Hypothetical
           protein W10G6.2b protein.
          Length = 463

 Score = 34.7 bits (76), Expect = 0.079
 Identities = 18/69 (26%), Positives = 33/69 (47%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HP  + ++F+         V+D+++  +LF  LQ +   S         ++  AL  LH+
Sbjct: 193 HPFLVSLHFSFQNKEKLYFVLDHLNGGELFSHLQREKHFSESRSRFYAAEIACALGYLHE 252

Query: 28  HNFIHNDIK 2
            N I+ D+K
Sbjct: 253 KNIIYRDLK 261


>Z81140-3|CAJ55246.1|  453|Caenorhabditis elegans Hypothetical
           protein W10G6.2a protein.
          Length = 453

 Score = 34.7 bits (76), Expect = 0.079
 Identities = 18/69 (26%), Positives = 33/69 (47%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HP  + ++F+         V+D+++  +LF  LQ +   S         ++  AL  LH+
Sbjct: 183 HPFLVSLHFSFQNKEKLYFVLDHLNGGELFSHLQREKHFSESRSRFYAAEIACALGYLHE 242

Query: 28  HNFIHNDIK 2
            N I+ D+K
Sbjct: 243 KNIIYRDLK 251


>Z48795-3|CAA88727.1|  414|Caenorhabditis elegans Hypothetical
           protein R05H5.4 protein.
          Length = 414

 Score = 34.7 bits (76), Expect = 0.079
 Identities = 29/83 (34%), Positives = 42/83 (50%), Gaps = 5/83 (6%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQV---IVMDYIDCPDLFETLQIKGELSH--QLVS 74
           E +V QL  DHPN +K    HGFI + +   +V++Y +   + + L+ KGE       V 
Sbjct: 167 EARVMQLY-DHPNIVKF---HGFILDDLPYLLVLEYCNGGAVEDRLRDKGEKIKVPTRVK 222

Query: 73  NIIRQLCEALNDLHKHNFIHNDI 5
                 C  ++ LHK N IH DI
Sbjct: 223 YTYMAAC-GMDYLHKKNCIHRDI 244


>U41996-8|AAA83477.1|  310|Caenorhabditis elegans Hypothetical
           protein F38E1.3 protein.
          Length = 310

 Score = 34.7 bits (76), Expect = 0.079
 Identities = 13/24 (54%), Positives = 17/24 (70%)
 Frame = -3

Query: 73  NIIRQLCEALNDLHKHNFIHNDIK 2
           ++ +Q  EA  DLHKH FIH D+K
Sbjct: 129 SVSQQCLEACEDLHKHGFIHRDLK 152


>AL132846-4|CAB60347.1|  328|Caenorhabditis elegans Hypothetical
           protein Y43D4A.6 protein.
          Length = 328

 Score = 34.7 bits (76), Expect = 0.079
 Identities = 17/69 (24%), Positives = 30/69 (43%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           H N +K+Y          +  +++   DLFE +  +  +    V   ++QL   L  +H 
Sbjct: 63  HKNIVKMYGMSMDTEFCYLFQEFVTGGDLFEKIDFENGMPVNQVKGYLKQLMSGLKYIHG 122

Query: 28  HNFIHNDIK 2
              +H DIK
Sbjct: 123 CGIVHRDIK 131


>AL022593-4|CAE54889.1|  921|Caenorhabditis elegans Hypothetical
           protein F33E2.2b protein.
          Length = 921

 Score = 34.7 bits (76), Expect = 0.079
 Identities = 13/51 (25%), Positives = 30/51 (58%)
 Frame = -3

Query: 154 IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           IVM+Y     L   L+ +  ++ +L +  ++++ + ++ LH++  IH D+K
Sbjct: 198 IVMEYCSKGQLCTVLKSRNTITRELFAQWVKEIADGMHYLHQNKVIHRDLK 248


>AL022593-3|CAA18635.3|  928|Caenorhabditis elegans Hypothetical
           protein F33E2.2a protein.
          Length = 928

 Score = 34.7 bits (76), Expect = 0.079
 Identities = 13/51 (25%), Positives = 30/51 (58%)
 Frame = -3

Query: 154 IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           IVM+Y     L   L+ +  ++ +L +  ++++ + ++ LH++  IH D+K
Sbjct: 198 IVMEYCSKGQLCTVLKSRNTITRELFAQWVKEIADGMHYLHQNKVIHRDLK 248


>AF106583-4|AAD03135.1|  417|Caenorhabditis elegans Hypothetical
           protein F23C8.7 protein.
          Length = 417

 Score = 34.7 bits (76), Expect = 0.079
 Identities = 19/69 (27%), Positives = 29/69 (42%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLH 32
           DHPN +K Y          ++M+  DC  L   LQ    L       +I Q    ++ +H
Sbjct: 178 DHPNVVKFYGVGASQEPLYVIMELADCGALDSYLQKNPNLVPDKKMEMIYQAACGISYMH 237

Query: 31  KHNFIHNDI 5
           +   +H DI
Sbjct: 238 EKKLLHRDI 246


>AF067608-9|AAC17652.1|  367|Caenorhabditis elegans Temporarily
           assigned gene nameprotein 344 protein.
          Length = 367

 Score = 34.7 bits (76), Expect = 0.079
 Identities = 18/69 (26%), Positives = 31/69 (44%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           H N  ++Y    F ++ + V +Y    DL   ++    +  +      RQL  AL  L  
Sbjct: 128 HDNICRLYEMISFQDHIIFVNEYCAGGDLLRKMKDIVAMKEEDAKFTFRQLIAALTHLQS 187

Query: 28  HNFIHNDIK 2
           +N +H D+K
Sbjct: 188 YNIVHRDLK 196


>U40935-5|AAM29686.1|  441|Caenorhabditis elegans Hypothetical
           protein F31E3.2a protein.
          Length = 441

 Score = 34.3 bits (75), Expect = 0.10
 Identities = 20/81 (24%), Positives = 38/81 (46%), Gaps = 2/81 (2%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYI--DCPDLFETLQIKGELSHQLVSNII 65
           E  + +L+  HP   + Y       +   ++ Y      DLF   + +G LS   +  I 
Sbjct: 175 EASIQRLLPSHPFIARTYSTWQTRTHLYSLLQYPTGSTGDLFSVWRQRGSLSEAAIRLIG 234

Query: 64  RQLCEALNDLHKHNFIHNDIK 2
            +L  A++ LH+++ I+ D+K
Sbjct: 235 AELASAIDFLHQNDVIYRDVK 255


>U40935-4|AAM29687.1|  436|Caenorhabditis elegans Hypothetical
           protein F31E3.2b protein.
          Length = 436

 Score = 34.3 bits (75), Expect = 0.10
 Identities = 20/81 (24%), Positives = 38/81 (46%), Gaps = 2/81 (2%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYI--DCPDLFETLQIKGELSHQLVSNII 65
           E  + +L+  HP   + Y       +   ++ Y      DLF   + +G LS   +  I 
Sbjct: 175 EASIQRLLPSHPFIARTYSTWQTRTHLYSLLQYPTGSTGDLFSVWRQRGSLSEAAIRLIG 234

Query: 64  RQLCEALNDLHKHNFIHNDIK 2
            +L  A++ LH+++ I+ D+K
Sbjct: 235 AELASAIDFLHQNDVIYRDVK 255


>AL032618-4|CAB63367.1|  353|Caenorhabditis elegans Hypothetical
           protein Y42A5A.4 protein.
          Length = 353

 Score = 34.3 bits (75), Expect = 0.10
 Identities = 18/51 (35%), Positives = 26/51 (50%)
 Frame = -3

Query: 154 IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           +V +  D   L E  +    ++ +L+  II QL EAL   H H  IH D+K
Sbjct: 78  LVFELCDRTVLHELEKNPHGVNDELIKKIIYQLLEALKFCHSHKCIHRDVK 128


>Z99276-2|CAB16482.1|  388|Caenorhabditis elegans Hypothetical
           protein Y52D3.1a protein.
          Length = 388

 Score = 33.9 bits (74), Expect = 0.14
 Identities = 19/71 (26%), Positives = 38/71 (53%), Gaps = 2/71 (2%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETL--QIKGELSHQLVSNIIRQLCEALNDL 35
           HPN I++     +  +   +   ++   LF+ +   +K  ++ +  + I RQL +AL+ L
Sbjct: 107 HPNIIELCECFVYERSIYQITPAMNLGSLFDIVFEYMKWGINEKSAAAITRQLLDALSYL 166

Query: 34  HKHNFIHNDIK 2
           H+  +IH D+K
Sbjct: 167 HQRRYIHRDLK 177


>Z92967-2|CAB07478.1| 1101|Caenorhabditis elegans Hypothetical protein
            T25E12.4a protein.
          Length = 1101

 Score = 33.9 bits (74), Expect = 0.14
 Identities = 21/72 (29%), Positives = 34/72 (47%), Gaps = 2/72 (2%)
 Frame = -3

Query: 211  DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETL--QIKGELSHQLVSNIIRQLCEALND 38
            DHP  +         +   +VM+ +   D+ E +    KG LS +    ++ Q+ EAL  
Sbjct: 825  DHPGVVHFMQMLETTDRIFVVMEKLK-GDMLEMILSSEKGRLSERTTQFLVAQILEALRY 883

Query: 37   LHKHNFIHNDIK 2
            LH  N +H D+K
Sbjct: 884  LHHLNIVHCDLK 895


>Z82059-9|CAB04875.1|  292|Caenorhabditis elegans Hypothetical
           protein T27E9.3 protein.
          Length = 292

 Score = 33.9 bits (74), Expect = 0.14
 Identities = 19/70 (27%), Positives = 34/70 (48%), Gaps = 1/70 (1%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQ-IKGELSHQLVSNIIRQLCEALNDLH 32
           H N +++Y      N   +V +Y D  DL +    + G +  Q   +++ QL   L+  H
Sbjct: 60  HRNVVRLYDVVHSENKLTLVFEYCD-QDLKKFFDSLNGYMDAQTARSLMLQLLRGLSFCH 118

Query: 31  KHNFIHNDIK 2
            H+ +H D+K
Sbjct: 119 AHHVLHRDLK 128


>Z82052-10|CAB04830.1| 1101|Caenorhabditis elegans Hypothetical
            protein T25E12.4a protein.
          Length = 1101

 Score = 33.9 bits (74), Expect = 0.14
 Identities = 21/72 (29%), Positives = 34/72 (47%), Gaps = 2/72 (2%)
 Frame = -3

Query: 211  DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETL--QIKGELSHQLVSNIIRQLCEALND 38
            DHP  +         +   +VM+ +   D+ E +    KG LS +    ++ Q+ EAL  
Sbjct: 825  DHPGVVHFMQMLETTDRIFVVMEKLK-GDMLEMILSSEKGRLSERTTQFLVAQILEALRY 883

Query: 37   LHKHNFIHNDIK 2
            LH  N +H D+K
Sbjct: 884  LHHLNIVHCDLK 895


>U40943-4|AAK39236.1|  270|Caenorhabditis elegans Hypothetical
           protein F47F2.1a protein.
          Length = 270

 Score = 33.9 bits (74), Expect = 0.14
 Identities = 14/69 (20%), Positives = 34/69 (49%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HP  +K+Y +    N+  ++M+++   ++F  L+     S+ +      ++  AL  +H 
Sbjct: 19  HPFIVKMYASEKDSNHLYMIMEFVPGGEMFSYLRASRSFSNSMARFYASEIVCALEYIHS 78

Query: 28  HNFIHNDIK 2
              ++ D+K
Sbjct: 79  LGIVYRDLK 87


>U40943-3|AAM69117.1|  325|Caenorhabditis elegans Hypothetical
           protein F47F2.1c protein.
          Length = 325

 Score = 33.9 bits (74), Expect = 0.14
 Identities = 14/69 (20%), Positives = 34/69 (49%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HP  +K+Y +    N+  ++M+++   ++F  L+     S+ +      ++  AL  +H 
Sbjct: 74  HPFIVKMYASEKDSNHLYMIMEFVPGGEMFSYLRASRSFSNSMARFYASEIVCALEYIHS 133

Query: 28  HNFIHNDIK 2
              ++ D+K
Sbjct: 134 LGIVYRDLK 142


>U40943-1|AAK72061.2|  398|Caenorhabditis elegans Hypothetical
           protein F47F2.1b protein.
          Length = 398

 Score = 33.9 bits (74), Expect = 0.14
 Identities = 14/69 (20%), Positives = 34/69 (49%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HP  +K+Y +    N+  ++M+++   ++F  L+     S+ +      ++  AL  +H 
Sbjct: 147 HPFIVKMYASEKDSNHLYMIMEFVPGGEMFSYLRASRSFSNSMARFYASEIVCALEYIHS 206

Query: 28  HNFIHNDIK 2
              ++ D+K
Sbjct: 207 LGIVYRDLK 215


>AL023843-2|CAA19523.1|  388|Caenorhabditis elegans Hypothetical
           protein Y52D3.1a protein.
          Length = 388

 Score = 33.9 bits (74), Expect = 0.14
 Identities = 19/71 (26%), Positives = 38/71 (53%), Gaps = 2/71 (2%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETL--QIKGELSHQLVSNIIRQLCEALNDL 35
           HPN I++     +  +   +   ++   LF+ +   +K  ++ +  + I RQL +AL+ L
Sbjct: 107 HPNIIELCECFVYERSIYQITPAMNLGSLFDIVFEYMKWGINEKSAAAITRQLLDALSYL 166

Query: 34  HKHNFIHNDIK 2
           H+  +IH D+K
Sbjct: 167 HQRRYIHRDLK 177


>AL021572-4|CAA16519.1| 1101|Caenorhabditis elegans Hypothetical
            protein T25E12.4a protein.
          Length = 1101

 Score = 33.9 bits (74), Expect = 0.14
 Identities = 21/72 (29%), Positives = 34/72 (47%), Gaps = 2/72 (2%)
 Frame = -3

Query: 211  DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETL--QIKGELSHQLVSNIIRQLCEALND 38
            DHP  +         +   +VM+ +   D+ E +    KG LS +    ++ Q+ EAL  
Sbjct: 825  DHPGVVHFMQMLETTDRIFVVMEKLK-GDMLEMILSSEKGRLSERTTQFLVAQILEALRY 883

Query: 37   LHKHNFIHNDIK 2
            LH  N +H D+K
Sbjct: 884  LHHLNIVHCDLK 895


>AL021507-1|CAA16430.1| 1101|Caenorhabditis elegans Hypothetical
            protein T25E12.4a protein.
          Length = 1101

 Score = 33.9 bits (74), Expect = 0.14
 Identities = 21/72 (29%), Positives = 34/72 (47%), Gaps = 2/72 (2%)
 Frame = -3

Query: 211  DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETL--QIKGELSHQLVSNIIRQLCEALND 38
            DHP  +         +   +VM+ +   D+ E +    KG LS +    ++ Q+ EAL  
Sbjct: 825  DHPGVVHFMQMLETTDRIFVVMEKLK-GDMLEMILSSEKGRLSERTTQFLVAQILEALRY 883

Query: 37   LHKHNFIHNDIK 2
            LH  N +H D+K
Sbjct: 884  LHHLNIVHCDLK 895


>AJ012357-1|CAB41352.1|  371|Caenorhabditis elegans cyclic
           AMP-dependent protein kinase,catalytic subunit protein.
          Length = 371

 Score = 33.9 bits (74), Expect = 0.14
 Identities = 14/69 (20%), Positives = 34/69 (49%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HP  +K+Y +    N+  ++M+++   ++F  L+     S+ +      ++  AL  +H 
Sbjct: 120 HPFIVKMYASEKDSNHLYMIMEFVPGGEMFSYLRASRSFSNSMARFYASEIVCALEYIHS 179

Query: 28  HNFIHNDIK 2
              ++ D+K
Sbjct: 180 LGIVYRDLK 188


>AF129111-1|AAD37121.1|  292|Caenorhabditis elegans cell division
           protein kinase 5 protein.
          Length = 292

 Score = 33.9 bits (74), Expect = 0.14
 Identities = 19/70 (27%), Positives = 34/70 (48%), Gaps = 1/70 (1%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQ-IKGELSHQLVSNIIRQLCEALNDLH 32
           H N +++Y      N   +V +Y D  DL +    + G +  Q   +++ QL   L+  H
Sbjct: 60  HRNVVRLYDVVHSENKLTLVFEYCD-QDLKKFFDSLNGYMDAQTARSLMLQLLRGLSFCH 118

Query: 31  KHNFIHNDIK 2
            H+ +H D+K
Sbjct: 119 AHHVLHRDLK 128


>U80842-3|AAB37947.1|  325|Caenorhabditis elegans Serpentine
           receptor, class i protein48 protein.
          Length = 325

 Score = 33.5 bits (73), Expect = 0.18
 Identities = 15/58 (25%), Positives = 32/58 (55%)
 Frame = +2

Query: 332 LIILYRVLTFLQFS*NCTSVCSVHLWRWWWP*RIVNMNLYNLIYSIIGTIKLMHINFL 505
           LI+ + +++F+ F  NCT++  +    +    +  N   + L++ +  TI  +HINF+
Sbjct: 11  LILYFNIVSFISFFLNCTTILLIIFKSY----KFNNFRFFVLVFQVTCTITDLHINFI 64


>U41263-3|AAC24425.1|  361|Caenorhabditis elegans Hypothetical
           protein T19D12.5 protein.
          Length = 361

 Score = 33.5 bits (73), Expect = 0.18
 Identities = 14/32 (43%), Positives = 20/32 (62%)
 Frame = -3

Query: 97  ELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           +LS   V  II Q+  AL DLH+  ++H D+K
Sbjct: 156 KLSQCSVGRIIHQVIAALQDLHETGYVHRDVK 187


>AF003145-6|AAK68678.1| 1420|Caenorhabditis elegans Mtk1/mekk4 homolog
            protein 1, isoformb protein.
          Length = 1420

 Score = 33.5 bits (73), Expect = 0.18
 Identities = 20/69 (28%), Positives = 30/69 (43%)
 Frame = -3

Query: 208  HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
            H N +K Y      ++ +I M+Y     L       G++  ++V      L  A+  LH 
Sbjct: 1178 HENLVKYYGVQVEDSDVIIFMEYCSQGTLERICH--GKMDLKMVRQYTNSLLRAVQYLHS 1235

Query: 28   HNFIHNDIK 2
            H  IH DIK
Sbjct: 1236 HKIIHRDIK 1244


>AF003145-5|AAB57718.1| 1418|Caenorhabditis elegans Mtk1/mekk4 homolog
            protein 1, isoforma protein.
          Length = 1418

 Score = 33.5 bits (73), Expect = 0.18
 Identities = 20/69 (28%), Positives = 30/69 (43%)
 Frame = -3

Query: 208  HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
            H N +K Y      ++ +I M+Y     L       G++  ++V      L  A+  LH 
Sbjct: 1178 HENLVKYYGVQVEDSDVIIFMEYCSQGTLERICH--GKMDLKMVRQYTNSLLRAVQYLHS 1235

Query: 28   HNFIHNDIK 2
            H  IH DIK
Sbjct: 1236 HKIIHRDIK 1244


>Z34533-1|CAA84302.3|  730|Caenorhabditis elegans Hypothetical
           protein B0285.1 protein.
          Length = 730

 Score = 33.1 bits (72), Expect = 0.24
 Identities = 18/56 (32%), Positives = 30/56 (53%), Gaps = 2/56 (3%)
 Frame = -3

Query: 163 NQVIVMDYIDCPDLFETLQIKG--ELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           N  +V +Y+D  DL   L+ K   + +   + ++ +QL E L  +H   F+H DIK
Sbjct: 392 NFYLVFEYVD-HDLIGLLESKELVDFNKDQICSLFKQLLEGLAYIHNTGFLHRDIK 446


>U13876-6|AAA21175.2|  444|Caenorhabditis elegans Hypothetical
           protein F57B9.8 protein.
          Length = 444

 Score = 33.1 bits (72), Expect = 0.24
 Identities = 20/69 (28%), Positives = 30/69 (43%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLH 32
           DH N +K Y         ++VM+ +    L + LQ    +      +II Q+   L  +H
Sbjct: 172 DHKNVVKCYGVAAIDEPLLVVMELVPGGALDKYLQKNSSVQWPEKLDIIAQVAAGLAYIH 231

Query: 31  KHNFIHNDI 5
             N IH DI
Sbjct: 232 SKNIIHRDI 240


>Z50873-1|CAA90760.2|  961|Caenorhabditis elegans Hypothetical
           protein F17E5.1a protein.
          Length = 961

 Score = 32.7 bits (71), Expect = 0.32
 Identities = 21/84 (25%), Positives = 43/84 (51%), Gaps = 4/84 (4%)
 Frame = -3

Query: 241 DEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDL-FETLQIKGE---LSHQLVS 74
           +EI++ Q +  HP   ++      ++ + I+ + ++  D+ FE +Q        S  +VS
Sbjct: 66  EEIRICQNLQ-HPYICRLEKTINSVHYRHIIFENMEGNDICFEIVQRASNGFVFSEYVVS 124

Query: 73  NIIRQLCEALNDLHKHNFIHNDIK 2
           +  RQL +AL+  H    +H D++
Sbjct: 125 HYTRQLLDALDYCHTRKIVHRDVR 148


>Z35637-1|CAA84687.1|  363|Caenorhabditis elegans Hypothetical
           protein C03C10.2 protein.
          Length = 363

 Score = 32.7 bits (71), Expect = 0.32
 Identities = 13/33 (39%), Positives = 18/33 (54%)
 Frame = -3

Query: 100 GELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           G LS + V  I  Q   AL D+H   ++H D+K
Sbjct: 165 GRLSKETVGRIAYQTLNALKDIHDMGYVHRDVK 197


>X92564-1|CAA63314.1|  961|Caenorhabditis elegans LIN-2A protein.
          Length = 961

 Score = 32.7 bits (71), Expect = 0.32
 Identities = 21/84 (25%), Positives = 43/84 (51%), Gaps = 4/84 (4%)
 Frame = -3

Query: 241 DEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDL-FETLQIKGE---LSHQLVS 74
           +EI++ Q +  HP   ++      ++ + I+ + ++  D+ FE +Q        S  +VS
Sbjct: 66  EEIRICQNLQ-HPYICRLEKTINSVHYRHIIFENMEGNDICFEIVQRASNGFVFSEYVVS 124

Query: 73  NIIRQLCEALNDLHKHNFIHNDIK 2
           +  RQL +AL+  H    +H D++
Sbjct: 125 HYTRQLLDALDYCHTRKIVHRDVR 148


>U80845-5|ABB51196.1|  423|Caenorhabditis elegans Temporarily
           assigned gene nameprotein 306 protein.
          Length = 423

 Score = 32.7 bits (71), Expect = 0.32
 Identities = 20/63 (31%), Positives = 33/63 (52%), Gaps = 1/63 (1%)
 Frame = -3

Query: 187 YFNHGFINNQVIVMDYIDCPDLFETLQIKGE-LSHQLVSNIIRQLCEALNDLHKHNFIHN 11
           YF H   ++  IVM+Y     + + ++ + + LS Q +S ++R   + L  LH    IH 
Sbjct: 97  YFKH---SDLWIVMEYCGAGSISDIMRARRKPLSEQEISAVLRDTLKGLQYLHDLKKIHR 153

Query: 10  DIK 2
           DIK
Sbjct: 154 DIK 156


>U61958-1|AAB03183.1|  416|Caenorhabditis elegans Hypothetical
           protein C25A8.5 protein.
          Length = 416

 Score = 32.7 bits (71), Expect = 0.32
 Identities = 19/69 (27%), Positives = 28/69 (40%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLH 32
           DHPN +K Y          ++M+  DC  L   LQ    L       +I Q    +  +H
Sbjct: 178 DHPNVVKFYGVGASQEPLYVIMELADCGALDSYLQKNPNLLPGKKMEMIYQAACGIAYMH 237

Query: 31  KHNFIHNDI 5
           +   +H DI
Sbjct: 238 EKKLLHRDI 246


>U57054-2|AAL50324.1|  372|Caenorhabditis elegans Jun n-terminal
           kinase protein 1,isoform b protein.
          Length = 372

 Score = 32.7 bits (71), Expect = 0.32
 Identities = 17/55 (30%), Positives = 32/55 (58%)
 Frame = -3

Query: 166 NNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           N+  IVM+ +D  +L + +Q+  +L H+ +S ++ Q+   +  LH    IH D+K
Sbjct: 104 NDLYIVMELMDA-NLCQVIQM--DLDHERLSYLLYQMLCGIRHLHSAGIIHRDLK 155


>U57054-1|AAA98724.2|  463|Caenorhabditis elegans Jun n-terminal
           kinase protein 1,isoform a protein.
          Length = 463

 Score = 32.7 bits (71), Expect = 0.32
 Identities = 17/55 (30%), Positives = 32/55 (58%)
 Frame = -3

Query: 166 NNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           N+  IVM+ +D  +L + +Q+  +L H+ +S ++ Q+   +  LH    IH D+K
Sbjct: 195 NDLYIVMELMDA-NLCQVIQM--DLDHERLSYLLYQMLCGIRHLHSAGIIHRDLK 246


>U00025-1|ABA54413.1|  589|Caenorhabditis elegans Amp-activated
           kinase protein 1,isoform a protein.
          Length = 589

 Score = 32.7 bits (71), Expect = 0.32
 Identities = 15/69 (21%), Positives = 33/69 (47%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HP+  +++      ++  +VM+ +   +LF  +  KG L  +      +Q+   ++  H 
Sbjct: 81  HPHITRLFRVISTPSDIFLVMELVSGGELFSYITRKGALPIRESRRYFQQIISGVSYCHN 140

Query: 28  HNFIHNDIK 2
           H  +H D+K
Sbjct: 141 HMIVHRDLK 149


>AY347272-1|AAR06927.1|  589|Caenorhabditis elegans AMP-activated
           protein kinase alphasubunit 2 protein.
          Length = 589

 Score = 32.7 bits (71), Expect = 0.32
 Identities = 15/69 (21%), Positives = 33/69 (47%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HP+  +++      ++  +VM+ +   +LF  +  KG L  +      +Q+   ++  H 
Sbjct: 81  HPHITRLFRVISTPSDIFLVMELVSGGELFSYITRKGALPIRESRRYFQQIISGVSYCHN 140

Query: 28  HNFIHNDIK 2
           H  +H D+K
Sbjct: 141 HMIVHRDLK 149


>AY077615-1|AAL79359.1|  510|Caenorhabditis elegans KSR-2b protein.
          Length = 510

 Score = 32.7 bits (71), Expect = 0.32
 Identities = 17/73 (23%), Positives = 32/73 (43%), Gaps = 2/73 (2%)
 Frame = -3

Query: 214 NDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETL--QIKGELSHQLVSNIIRQLCEALN 41
           +DH      Y +    N   IV ++     L+  +  Q+  +        I  Q+C+A++
Sbjct: 264 HDHIALFYGYVSDPVTNTYAIVTNFYQHNTLYHRIHEQLSEDFDQSWTFQISLQICQAMS 323

Query: 40  DLHKHNFIHNDIK 2
            LHK   +H D++
Sbjct: 324 YLHKKKILHRDLR 336


>AY077614-1|AAL79358.1|  550|Caenorhabditis elegans KSR-2a protein.
          Length = 550

 Score = 32.7 bits (71), Expect = 0.32
 Identities = 17/73 (23%), Positives = 32/73 (43%), Gaps = 2/73 (2%)
 Frame = -3

Query: 214 NDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETL--QIKGELSHQLVSNIIRQLCEALN 41
           +DH      Y +    N   IV ++     L+  +  Q+  +        I  Q+C+A++
Sbjct: 304 HDHIALFYGYVSDPVTNTYAIVTNFYQHNTLYHRIHEQLSEDFDQSWTFQISLQICQAMS 363

Query: 40  DLHKHNFIHNDIK 2
            LHK   +H D++
Sbjct: 364 YLHKKKILHRDLR 376


>AL137227-5|CAB70240.2|  510|Caenorhabditis elegans Hypothetical
           protein F58D5.4b protein.
          Length = 510

 Score = 32.7 bits (71), Expect = 0.32
 Identities = 17/73 (23%), Positives = 32/73 (43%), Gaps = 2/73 (2%)
 Frame = -3

Query: 214 NDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETL--QIKGELSHQLVSNIIRQLCEALN 41
           +DH      Y +    N   IV ++     L+  +  Q+  +        I  Q+C+A++
Sbjct: 264 HDHIALFYGYVSDPVTNTYAIVTNFYQHNTLYHRIHEQLSEDFDQSWTFQISLQICQAMS 323

Query: 40  DLHKHNFIHNDIK 2
            LHK   +H D++
Sbjct: 324 YLHKKKILHRDLR 336


>AL137227-4|CAB70239.2|  550|Caenorhabditis elegans Hypothetical
           protein F58D5.4a protein.
          Length = 550

 Score = 32.7 bits (71), Expect = 0.32
 Identities = 17/73 (23%), Positives = 32/73 (43%), Gaps = 2/73 (2%)
 Frame = -3

Query: 214 NDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETL--QIKGELSHQLVSNIIRQLCEALN 41
           +DH      Y +    N   IV ++     L+  +  Q+  +        I  Q+C+A++
Sbjct: 304 HDHIALFYGYVSDPVTNTYAIVTNFYQHNTLYHRIHEQLSEDFDQSWTFQISLQICQAMS 363

Query: 40  DLHKHNFIHNDIK 2
            LHK   +H D++
Sbjct: 364 YLHKKKILHRDLR 376


>AF271359-1|AAF75788.1|  497|Caenorhabditis elegans STE20-like
           kinase MST protein.
          Length = 497

 Score = 32.7 bits (71), Expect = 0.32
 Identities = 20/63 (31%), Positives = 33/63 (52%), Gaps = 1/63 (1%)
 Frame = -3

Query: 187 YFNHGFINNQVIVMDYIDCPDLFETLQIKGE-LSHQLVSNIIRQLCEALNDLHKHNFIHN 11
           YF H   ++  IVM+Y     + + ++ + + LS Q +S ++R   + L  LH    IH 
Sbjct: 97  YFKH---SDLWIVMEYCGAGSISDIMRARRKPLSEQEISAVLRDTLKGLQYLHDLKKIHR 153

Query: 10  DIK 2
           DIK
Sbjct: 154 DIK 156


>AC006630-2|ABD63233.1|  495|Caenorhabditis elegans Hypothetical
           protein F14H12.4a protein.
          Length = 495

 Score = 32.7 bits (71), Expect = 0.32
 Identities = 20/63 (31%), Positives = 33/63 (52%), Gaps = 1/63 (1%)
 Frame = -3

Query: 187 YFNHGFINNQVIVMDYIDCPDLFETLQIKGE-LSHQLVSNIIRQLCEALNDLHKHNFIHN 11
           YF H   ++  IVM+Y     + + ++ + + LS Q +S ++R   + L  LH    IH 
Sbjct: 97  YFKH---SDLWIVMEYCGAGSISDIMRARRKPLSEQEISAVLRDTLKGLQYLHDLKKIHR 153

Query: 10  DIK 2
           DIK
Sbjct: 154 DIK 156


>AC006630-1|ABD63234.1|  497|Caenorhabditis elegans Hypothetical
           protein F14H12.4b protein.
          Length = 497

 Score = 32.7 bits (71), Expect = 0.32
 Identities = 20/63 (31%), Positives = 33/63 (52%), Gaps = 1/63 (1%)
 Frame = -3

Query: 187 YFNHGFINNQVIVMDYIDCPDLFETLQIKGE-LSHQLVSNIIRQLCEALNDLHKHNFIHN 11
           YF H   ++  IVM+Y     + + ++ + + LS Q +S ++R   + L  LH    IH 
Sbjct: 97  YFKH---SDLWIVMEYCGAGSISDIMRARRKPLSEQEISAVLRDTLKGLQYLHDLKKIHR 153

Query: 10  DIK 2
           DIK
Sbjct: 154 DIK 156


>AB024085-1|BAA82640.1|  463|Caenorhabditis elegans JNK-1 protein.
          Length = 463

 Score = 32.7 bits (71), Expect = 0.32
 Identities = 17/55 (30%), Positives = 32/55 (58%)
 Frame = -3

Query: 166 NNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           N+  IVM+ +D  +L + +Q+  +L H+ +S ++ Q+   +  LH    IH D+K
Sbjct: 195 NDLYIVMELMDA-NLCQVIQM--DLDHERLSYLLYQMLCGIRHLHSAGIIHRDLK 246


>Z80219-7|CAN86594.1|  804|Caenorhabditis elegans Hypothetical
           protein T01H8.1e protein.
          Length = 804

 Score = 32.3 bits (70), Expect = 0.42
 Identities = 16/69 (23%), Positives = 32/69 (46%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HP  +K+++         +++D++   DLF  L  +   +   V   + +L  AL  LH 
Sbjct: 157 HPFIVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEDDVKFYLAELTLALEHLHS 216

Query: 28  HNFIHNDIK 2
              ++ D+K
Sbjct: 217 LGIVYRDLK 225


>Z80219-6|CAI70409.1|  734|Caenorhabditis elegans Hypothetical
           protein T01H8.1d protein.
          Length = 734

 Score = 32.3 bits (70), Expect = 0.42
 Identities = 16/69 (23%), Positives = 32/69 (46%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HP  +K+++         +++D++   DLF  L  +   +   V   + +L  AL  LH 
Sbjct: 144 HPFIVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEDDVKFYLAELTLALEHLHS 203

Query: 28  HNFIHNDIK 2
              ++ D+K
Sbjct: 204 LGIVYRDLK 212


>Z80219-5|CAB02302.2|  784|Caenorhabditis elegans Hypothetical
           protein T01H8.1a protein.
          Length = 784

 Score = 32.3 bits (70), Expect = 0.42
 Identities = 16/69 (23%), Positives = 32/69 (46%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HP  +K+++         +++D++   DLF  L  +   +   V   + +L  AL  LH 
Sbjct: 163 HPFIVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEDDVKFYLAELTLALEHLHS 222

Query: 28  HNFIHNDIK 2
              ++ D+K
Sbjct: 223 LGIVYRDLK 231


>Z80219-4|CAE17938.1|  745|Caenorhabditis elegans Hypothetical
           protein T01H8.1c protein.
          Length = 745

 Score = 32.3 bits (70), Expect = 0.42
 Identities = 16/69 (23%), Positives = 32/69 (46%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HP  +K+++         +++D++   DLF  L  +   +   V   + +L  AL  LH 
Sbjct: 124 HPFIVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEDDVKFYLAELTLALEHLHS 183

Query: 28  HNFIHNDIK 2
              ++ D+K
Sbjct: 184 LGIVYRDLK 192


>Z80219-1|CAB02301.2|  727|Caenorhabditis elegans Hypothetical
           protein T01H8.1b protein.
          Length = 727

 Score = 32.3 bits (70), Expect = 0.42
 Identities = 16/69 (23%), Positives = 32/69 (46%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HP  +K+++         +++D++   DLF  L  +   +   V   + +L  AL  LH 
Sbjct: 106 HPFIVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEDDVKFYLAELTLALEHLHS 165

Query: 28  HNFIHNDIK 2
              ++ D+K
Sbjct: 166 LGIVYRDLK 174


>Z75546-12|CAN86896.1|  804|Caenorhabditis elegans Hypothetical
           protein T01H8.1e protein.
          Length = 804

 Score = 32.3 bits (70), Expect = 0.42
 Identities = 16/69 (23%), Positives = 32/69 (46%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HP  +K+++         +++D++   DLF  L  +   +   V   + +L  AL  LH 
Sbjct: 157 HPFIVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEDDVKFYLAELTLALEHLHS 216

Query: 28  HNFIHNDIK 2
              ++ D+K
Sbjct: 217 LGIVYRDLK 225


>Z75546-11|CAI70402.1|  734|Caenorhabditis elegans Hypothetical
           protein T01H8.1d protein.
          Length = 734

 Score = 32.3 bits (70), Expect = 0.42
 Identities = 16/69 (23%), Positives = 32/69 (46%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HP  +K+++         +++D++   DLF  L  +   +   V   + +L  AL  LH 
Sbjct: 144 HPFIVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEDDVKFYLAELTLALEHLHS 203

Query: 28  HNFIHNDIK 2
              ++ D+K
Sbjct: 204 LGIVYRDLK 212


>Z75546-10|CAA99896.2|  784|Caenorhabditis elegans Hypothetical
           protein T01H8.1a protein.
          Length = 784

 Score = 32.3 bits (70), Expect = 0.42
 Identities = 16/69 (23%), Positives = 32/69 (46%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HP  +K+++         +++D++   DLF  L  +   +   V   + +L  AL  LH 
Sbjct: 163 HPFIVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEDDVKFYLAELTLALEHLHS 222

Query: 28  HNFIHNDIK 2
              ++ D+K
Sbjct: 223 LGIVYRDLK 231


>Z75546-9|CAE17895.1|  745|Caenorhabditis elegans Hypothetical
           protein T01H8.1c protein.
          Length = 745

 Score = 32.3 bits (70), Expect = 0.42
 Identities = 16/69 (23%), Positives = 32/69 (46%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HP  +K+++         +++D++   DLF  L  +   +   V   + +L  AL  LH 
Sbjct: 124 HPFIVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEDDVKFYLAELTLALEHLHS 183

Query: 28  HNFIHNDIK 2
              ++ D+K
Sbjct: 184 LGIVYRDLK 192


>Z70750-9|CAA94735.2|  317|Caenorhabditis elegans Hypothetical
           protein C50F4.10 protein.
          Length = 317

 Score = 32.3 bits (70), Expect = 0.42
 Identities = 15/35 (42%), Positives = 20/35 (57%)
 Frame = -3

Query: 106 IKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           + G +S     ++  QL EAL DLH   FIH D+K
Sbjct: 112 MSGAISVNCALSVGIQLIEALEDLHNCGFIHRDLK 146


>U13645-2|AAM15543.1|  367|Caenorhabditis elegans Hypothetical
           protein C05D10.2c protein.
          Length = 367

 Score = 32.3 bits (70), Expect = 0.42
 Identities = 23/81 (28%), Positives = 38/81 (46%), Gaps = 2/81 (2%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVM--DYIDCPDLFETLQIKGELSHQLVSNII 65
           E+   Q    HPN IK+Y      N++ I +  ++++  DL   ++    L       I+
Sbjct: 60  EVMFLQEFGKHPNVIKLYNIFRADNDRDIYLAFEFMEA-DLHNVIKKGSILKDVHKQYIM 118

Query: 64  RQLCEALNDLHKHNFIHNDIK 2
            QL  A+  LH  N +H D+K
Sbjct: 119 CQLFRAIRFLHSGNVLHRDLK 139


>U13645-1|AAA20987.2|  470|Caenorhabditis elegans Hypothetical
           protein C05D10.2a protein.
          Length = 470

 Score = 32.3 bits (70), Expect = 0.42
 Identities = 23/81 (28%), Positives = 38/81 (46%), Gaps = 2/81 (2%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVM--DYIDCPDLFETLQIKGELSHQLVSNII 65
           E+   Q    HPN IK+Y      N++ I +  ++++  DL   ++    L       I+
Sbjct: 60  EVMFLQEFGKHPNVIKLYNIFRADNDRDIYLAFEFMEA-DLHNVIKKGSILKDVHKQYIM 118

Query: 64  RQLCEALNDLHKHNFIHNDIK 2
            QL  A+  LH  N +H D+K
Sbjct: 119 CQLFRAIRFLHSGNVLHRDLK 139


>U58750-2|AAB00642.1|  615|Caenorhabditis elegans Polo kinase
           protein 3 protein.
          Length = 615

 Score = 31.9 bits (69), Expect = 0.56
 Identities = 21/81 (25%), Positives = 39/81 (48%), Gaps = 2/81 (2%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCP--DLFETLQIKGELSHQLVSNII 65
           E+++H+ ++ H N ++  F+H F ++Q +      C    L E  + +G L+        
Sbjct: 83  EVEIHRQLS-HRNIVQ--FHHFFEDSQNVYFTLELCSKNSLMELNKQRGPLTEHEARFYT 139

Query: 64  RQLCEALNDLHKHNFIHNDIK 2
            Q+ E +  LH    IH D+K
Sbjct: 140 IQVAEGVKHLHNLQIIHRDLK 160


>AF100305-2|AAC68917.1|  320|Caenorhabditis elegans Hypothetical
           protein W04B5.5 protein.
          Length = 320

 Score = 31.9 bits (69), Expect = 0.56
 Identities = 18/73 (24%), Positives = 30/73 (41%), Gaps = 2/73 (2%)
 Frame = -3

Query: 214 NDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSN--IIRQLCEALN 41
           N HP  + +Y       +   V++Y    DL   +Q + +    +  +      L  AL 
Sbjct: 90  NAHPGIVTLYATFQDSESLYFVLEYAKYGDLCTLMQKQPDSKFNVADSRYYAANLLSALE 149

Query: 40  DLHKHNFIHNDIK 2
            +HK   IH D+K
Sbjct: 150 HIHKLGIIHRDVK 162


>AF059024-1|AAC14425.1|  615|Caenorhabditis elegans polo-like kinase
           protein.
          Length = 615

 Score = 31.9 bits (69), Expect = 0.56
 Identities = 21/81 (25%), Positives = 39/81 (48%), Gaps = 2/81 (2%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCP--DLFETLQIKGELSHQLVSNII 65
           E+++H+ ++ H N ++  F+H F ++Q +      C    L E  + +G L+        
Sbjct: 83  EVEIHRQLS-HRNIVQ--FHHFFEDSQNVYFTLELCSKNSLMELNKQRGPLTEHEARFYT 139

Query: 64  RQLCEALNDLHKHNFIHNDIK 2
            Q+ E +  LH    IH D+K
Sbjct: 140 IQVAEGVKHLHNLQIIHRDLK 160


>Z75541-2|CAA99854.2|  301|Caenorhabditis elegans Hypothetical
           protein F52B5.2 protein.
          Length = 301

 Score = 31.5 bits (68), Expect = 0.74
 Identities = 24/92 (26%), Positives = 41/92 (44%), Gaps = 5/92 (5%)
 Frame = -3

Query: 262 FGANFNVDEIKVHQLMNDHP---NFIKIY--FNHGFINNQVIVMDYIDCPDLFETLQIKG 98
           F   +  DEIK   ++ +H    N +++   F    I   ++   Y    DLF  L  + 
Sbjct: 50  FKCGYGEDEIKYLDVLTNHEQRRNIVEMLKSFETPEIRLGMVFKRYET--DLFGILGDRQ 107

Query: 97  ELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
            L    +   ++ L E L  +H+ ++IH DIK
Sbjct: 108 RLQPSTIQKYMKGLMEGLQFIHRMDYIHRDIK 139


>Z34800-4|CAA84323.2|  441|Caenorhabditis elegans Hypothetical
           protein F45H7.4 protein.
          Length = 441

 Score = 31.5 bits (68), Expect = 0.74
 Identities = 13/53 (24%), Positives = 32/53 (60%), Gaps = 1/53 (1%)
 Frame = -3

Query: 157 VIVMDY-IDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           +IVM+    C D+F+ ++ +G++S  +   + RQ+   +++  ++  +H D+K
Sbjct: 108 LIVMERPYPCIDMFDFIKGQGKISEDMARFLFRQIAVTVHECVQNRVLHRDLK 160


>U53153-6|AAT81184.1|  638|Caenorhabditis elegans Germinal center
           kinase family protein1, isoform d protein.
          Length = 638

 Score = 31.5 bits (68), Expect = 0.74
 Identities = 16/51 (31%), Positives = 27/51 (52%)
 Frame = -3

Query: 154 IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           I+M+Y+      + L   G+L    ++ I+R++ + L  LH    IH DIK
Sbjct: 92  IIMEYLGGGSALD-LTKSGKLDESHIAVILREILKGLEYLHSERKIHRDIK 141


>U53153-5|AAK77641.1|  651|Caenorhabditis elegans Germinal center
           kinase family protein1, isoform b protein.
          Length = 651

 Score = 31.5 bits (68), Expect = 0.74
 Identities = 16/51 (31%), Positives = 27/51 (52%)
 Frame = -3

Query: 154 IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           I+M+Y+      + L   G+L    ++ I+R++ + L  LH    IH DIK
Sbjct: 105 IIMEYLGGGSALD-LTKSGKLDESHIAVILREILKGLEYLHSERKIHRDIK 154


>U53153-4|AAK77642.2|  650|Caenorhabditis elegans Germinal center
           kinase family protein1, isoform c protein.
          Length = 650

 Score = 31.5 bits (68), Expect = 0.74
 Identities = 16/51 (31%), Positives = 27/51 (52%)
 Frame = -3

Query: 154 IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           I+M+Y+      + L   G+L    ++ I+R++ + L  LH    IH DIK
Sbjct: 105 IIMEYLGGGSALD-LTKSGKLDESHIAVILREILKGLEYLHSERKIHRDIK 154


>U53153-3|AAC69038.1|  653|Caenorhabditis elegans Germinal center
           kinase family protein1, isoform a protein.
          Length = 653

 Score = 31.5 bits (68), Expect = 0.74
 Identities = 16/51 (31%), Positives = 27/51 (52%)
 Frame = -3

Query: 154 IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           I+M+Y+      + L   G+L    ++ I+R++ + L  LH    IH DIK
Sbjct: 107 IIMEYLGGGSALD-LTKSGKLDESHIAVILREILKGLEYLHSERKIHRDIK 156


>U41550-5|AAA83287.4|  402|Caenorhabditis elegans Hypothetical
           protein R04A9.7 protein.
          Length = 402

 Score = 31.5 bits (68), Expect = 0.74
 Identities = 15/80 (18%), Positives = 39/80 (48%)
 Frame = -3

Query: 241 DEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIR 62
           DE K+ + +N  P    +++         +V++++   +L+  L+ K +   +     + 
Sbjct: 100 DERKILETINS-PFLCDLHYAFQTNEKLYLVLEFLHGGELYTLLERKSDWPEEYARFYLS 158

Query: 61  QLCEALNDLHKHNFIHNDIK 2
           ++  A+  LH H+ ++ D+K
Sbjct: 159 EIILAIEHLHGHDIVYRDLK 178


>Z49128-1|CAA88953.1|  379|Caenorhabditis elegans Hypothetical
           protein M03C11.1 protein.
          Length = 379

 Score = 31.1 bits (67), Expect = 0.98
 Identities = 16/69 (23%), Positives = 32/69 (46%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HP  + +++     +   +V D +   DL   L  +G+ +       + ++C A+  LH+
Sbjct: 85  HPFIVNLWYTFQDGDYMYMVSDLLLGGDLRYHLSQQGKFAEDRAKLYLCEICLAVEYLHE 144

Query: 28  HNFIHNDIK 2
              +H DIK
Sbjct: 145 MKIVHRDIK 153


>U97407-1|AAB52478.2|  411|Caenorhabditis elegans Hypothetical
           protein C34G6.5 protein.
          Length = 411

 Score = 31.1 bits (67), Expect = 0.98
 Identities = 22/80 (27%), Positives = 39/80 (48%), Gaps = 1/80 (1%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETL-QIKGELSHQLVSNIIR 62
           E+++   +  H N +K++    F  +  IV+++       E L   K +LS  L  +  R
Sbjct: 71  ELELLSELGGHFNIVKLFEFFHFNGSVAIVLEHFPHCTATELLFHSKRDLSFAL--SYFR 128

Query: 61  QLCEALNDLHKHNFIHNDIK 2
            L  A+  LH + ++H DIK
Sbjct: 129 NLLYAVAYLHHNGYVHRDIK 148


>AC006814-3|AAF60861.1|  382|Caenorhabditis elegans Hypothetical
           protein Y69F12A.1 protein.
          Length = 382

 Score = 31.1 bits (67), Expect = 0.98
 Identities = 20/71 (28%), Positives = 38/71 (53%), Gaps = 3/71 (4%)
 Frame = -3

Query: 205 PNFIKIYFNHGFINNQVI-VMDYIDCPDLFETLQIKGELSHQLVSN--IIRQLCEALNDL 35
           P+F+++  +HG +NN+ + V+  +   +L++      +  + L +   I  Q    L DL
Sbjct: 126 PHFLEMV-DHGIVNNRFLFVVLKLVGMNLWDMRAHLPDKKYTLTTTLRIAEQTLAGLRDL 184

Query: 34  HKHNFIHNDIK 2
           H+  F+H DIK
Sbjct: 185 HRVGFLHRDIK 195


>Z81116-7|CAB03306.1|  669|Caenorhabditis elegans Hypothetical
           protein T06C12.8 protein.
          Length = 669

 Score = 30.7 bits (66), Expect = 1.3
 Identities = 26/91 (28%), Positives = 41/91 (45%), Gaps = 1/91 (1%)
 Frame = -1

Query: 516 YRRFKKLMCINFIVPIIE*IRLYRFIFTIRHGHHHRHKCTLQTLVQFYENCKN-VKTRYK 340
           YRRFK+L+ +  +V ++  +  Y F F I     +R       L  F  N  N VK  Y 
Sbjct: 74  YRRFKRLLPLYLLVILLSLLFFYNF-FPITTTETNRSSAVRALL--FVSNWPNPVKLAYN 130

Query: 339 IINGRFGKISILSHKPTSKLYLQKTISAPIL 247
            +N R G   I +H  +  + +Q     P++
Sbjct: 131 AMNERTG--DIFAHTWSLSVEIQFYFLVPVI 159


>Z70267-6|CAA94212.1|  255|Caenorhabditis elegans Hypothetical
           protein K04C1.5 protein.
          Length = 255

 Score = 30.7 bits (66), Expect = 1.3
 Identities = 18/69 (26%), Positives = 35/69 (50%), Gaps = 2/69 (2%)
 Frame = -3

Query: 202 NFIKIYFNH-GFINNQVIVMD-YIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           N + +   H  +   +V+VMD Y++  + F   +   +LS ++V  +  +L   L  +H+
Sbjct: 27  NGVPVVHKHFQYEQKRVLVMDKYLENLEQFRKRKEDEKLSPRVVIKLAFRLVSILEHIHR 86

Query: 28  HNFIHNDIK 2
              +H DIK
Sbjct: 87  KGVVHQDIK 95


>Z69386-2|CAA93431.1|  305|Caenorhabditis elegans Hypothetical
           protein ZK596.2 protein.
          Length = 305

 Score = 30.7 bits (66), Expect = 1.3
 Identities = 12/24 (50%), Positives = 16/24 (66%)
 Frame = -3

Query: 73  NIIRQLCEALNDLHKHNFIHNDIK 2
           ++ RQ  EA+ DLH   F+H DIK
Sbjct: 124 SVARQSLEAVEDLHNIGFLHRDIK 147


>Z50795-6|CAD59152.2|  707|Caenorhabditis elegans Hypothetical
           protein R166.5b protein.
          Length = 707

 Score = 30.7 bits (66), Expect = 1.3
 Identities = 15/79 (18%), Positives = 34/79 (43%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+ + +   DHPN +++        N  +VM+ +    L + +  +   + +    + + 
Sbjct: 249 EVNIFKTCKDHPNIVQLLDWFEDETNFYLVMEKMRGGPLLQHILQRKYFTEEEARRVTKD 308

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  AL  +H     H D+K
Sbjct: 309 ISLALKFMHDRGIAHRDVK 327


>Z50795-5|CAA90665.2|  705|Caenorhabditis elegans Hypothetical
           protein R166.5a protein.
          Length = 705

 Score = 30.7 bits (66), Expect = 1.3
 Identities = 15/79 (18%), Positives = 34/79 (43%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+ + +   DHPN +++        N  +VM+ +    L + +  +   + +    + + 
Sbjct: 247 EVNIFKTCKDHPNIVQLLDWFEDETNFYLVMEKMRGGPLLQHILQRKYFTEEEARRVTKD 306

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  AL  +H     H D+K
Sbjct: 307 ISLALKFMHDRGIAHRDVK 325


>U41031-1|AAA82618.2|  562|Caenorhabditis elegans Abnormal cell
           lineage protein 18 protein.
          Length = 562

 Score = 30.7 bits (66), Expect = 1.3
 Identities = 13/29 (44%), Positives = 20/29 (68%)
 Frame = -3

Query: 91  SHQLVSNIIRQLCEALNDLHKHNFIHNDI 5
           +HQLVS +  Q+  A+  +HK+  +HNDI
Sbjct: 391 THQLVS-LATQVSSAVAHIHKYRIVHNDI 418


>AY741200-1|AAU89102.1|  596|Caenorhabditis elegans STE20-like
           serine/threonine kinase protein.
          Length = 596

 Score = 30.7 bits (66), Expect = 1.3
 Identities = 24/96 (25%), Positives = 44/96 (45%), Gaps = 14/96 (14%)
 Frame = -3

Query: 247 NVDEIKVH-QLMN--DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIK-------- 101
           +VDE+    Q M+  +HPN +  Y +        +VM  ++C  + + L+ K        
Sbjct: 147 SVDELSHEIQAMSQCNHPNVVSYYTSFIAQEELWVVMRLLNCGSMLDILKRKVKAIGKEQ 206

Query: 100 ---GELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
              G L    ++ ++R++ + L   H +  IH DIK
Sbjct: 207 AQFGVLDEVSIATVLREVLKGLEYFHLNGQIHRDIK 242


>AL132898-15|CAC14417.2|  596|Caenorhabditis elegans Hypothetical
           protein Y59A8B.23 protein.
          Length = 596

 Score = 30.7 bits (66), Expect = 1.3
 Identities = 24/96 (25%), Positives = 44/96 (45%), Gaps = 14/96 (14%)
 Frame = -3

Query: 247 NVDEIKVH-QLMN--DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIK-------- 101
           +VDE+    Q M+  +HPN +  Y +        +VM  ++C  + + L+ K        
Sbjct: 147 SVDELSHEIQAMSQCNHPNVVSYYTSFIAQEELWVVMRLLNCGSMLDILKRKVKAIGKEQ 206

Query: 100 ---GELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
              G L    ++ ++R++ + L   H +  IH DIK
Sbjct: 207 AQFGVLDEVSIATVLREVLKGLEYFHLNGQIHRDIK 242


>AF285179-1|AAG15377.1|  706|Caenorhabditis elegans zygote
           defective-1 protein.
          Length = 706

 Score = 30.7 bits (66), Expect = 1.3
 Identities = 15/50 (30%), Positives = 27/50 (54%)
 Frame = -3

Query: 154 IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDI 5
           IVM+  +   L   ++  G L      +++RQL  A++ +H+ N IH D+
Sbjct: 83  IVMELCEGGSLQAYVREHGALDDATAVHVLRQLISAVSFMHRVNVIHRDL 132


>AF133217-1|AAD24877.1|  583|Caenorhabditis elegans tyrosine kinase
           receptor-relatedprotein precursor RYK protein.
          Length = 583

 Score = 30.7 bits (66), Expect = 1.3
 Identities = 13/29 (44%), Positives = 20/29 (68%)
 Frame = -3

Query: 91  SHQLVSNIIRQLCEALNDLHKHNFIHNDI 5
           +HQLVS +  Q+  A+  +HK+  +HNDI
Sbjct: 412 THQLVS-LATQVSSAVAHIHKYRIVHNDI 439


>AF039715-5|AAB96730.1|  391|Caenorhabditis elegans Hypothetical
           protein R06A10.4 protein.
          Length = 391

 Score = 30.7 bits (66), Expect = 1.3
 Identities = 17/69 (24%), Positives = 29/69 (42%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HP  I++       +   IVM      ++++ +  KG  S +   N ++ L   L  LH 
Sbjct: 121 HPFVIRLEEVFKSSSKLFIVMQMASGGEMYDRVVAKGRYSEEEARNALKMLLTGLTYLHS 180

Query: 28  HNFIHNDIK 2
               H D+K
Sbjct: 181 IRVTHRDLK 189


>AF003386-12|AAB54253.2|  706|Caenorhabditis elegans Zygote
           defective: embryonic lethalprotein 1 protein.
          Length = 706

 Score = 30.7 bits (66), Expect = 1.3
 Identities = 15/50 (30%), Positives = 27/50 (54%)
 Frame = -3

Query: 154 IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDI 5
           IVM+  +   L   ++  G L      +++RQL  A++ +H+ N IH D+
Sbjct: 83  IVMELCEGGSLQAYVREHGALDDATAVHVLRQLISAVSFMHRVNVIHRDL 132


>Z99773-4|CAB16925.1|  342|Caenorhabditis elegans Hypothetical
           protein F18H3.5a protein.
          Length = 342

 Score = 30.3 bits (65), Expect = 1.7
 Identities = 32/104 (30%), Positives = 48/104 (46%), Gaps = 9/104 (8%)
 Frame = -3

Query: 286 QIVFAENNFGANFNV-DEIKV--HQLMNDHPNFI--KIYFNHGFINNQVIVMDYI--DCP 128
           QI+ +  N G   +V  EI V  H     HPN I  K  F+       ++ ++ I   C 
Sbjct: 68  QIMISSKNEGIPQSVLREITVMKHLARKAHPNIISLKSVFHQLDPVRAILKINMIMERCD 127

Query: 127 -DLFETLQ-IKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
            DL   L+ I   +  Q   ++  Q+  AL+ LH H+ IH D+K
Sbjct: 128 WDLHTFLRNIPRGVPEQQAKHVTAQIVRALDFLHTHSIIHRDLK 171


>Z99773-1|CAB16923.2|  406|Caenorhabditis elegans Hypothetical
           protein F18H3.5b protein.
          Length = 406

 Score = 30.3 bits (65), Expect = 1.7
 Identities = 32/104 (30%), Positives = 48/104 (46%), Gaps = 9/104 (8%)
 Frame = -3

Query: 286 QIVFAENNFGANFNV-DEIKV--HQLMNDHPNFI--KIYFNHGFINNQVIVMDYI--DCP 128
           QI+ +  N G   +V  EI V  H     HPN I  K  F+       ++ ++ I   C 
Sbjct: 132 QIMISSKNEGIPQSVLREITVMKHLARKAHPNIISLKSVFHQLDPVRAILKINMIMERCD 191

Query: 127 -DLFETLQ-IKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
            DL   L+ I   +  Q   ++  Q+  AL+ LH H+ IH D+K
Sbjct: 192 WDLHTFLRNIPRGVPEQQAKHVTAQIVRALDFLHTHSIIHRDLK 235


>Z50110-5|CAA90447.1|  342|Caenorhabditis elegans Hypothetical
           protein F18H3.5a protein.
          Length = 342

 Score = 30.3 bits (65), Expect = 1.7
 Identities = 32/104 (30%), Positives = 48/104 (46%), Gaps = 9/104 (8%)
 Frame = -3

Query: 286 QIVFAENNFGANFNV-DEIKV--HQLMNDHPNFI--KIYFNHGFINNQVIVMDYI--DCP 128
           QI+ +  N G   +V  EI V  H     HPN I  K  F+       ++ ++ I   C 
Sbjct: 68  QIMISSKNEGIPQSVLREITVMKHLARKAHPNIISLKSVFHQLDPVRAILKINMIMERCD 127

Query: 127 -DLFETLQ-IKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
            DL   L+ I   +  Q   ++  Q+  AL+ LH H+ IH D+K
Sbjct: 128 WDLHTFLRNIPRGVPEQQAKHVTAQIVRALDFLHTHSIIHRDLK 171


>Z36752-7|CAA85329.1|  468|Caenorhabditis elegans Hypothetical
           protein F35H8.7 protein.
          Length = 468

 Score = 30.3 bits (65), Expect = 1.7
 Identities = 19/76 (25%), Positives = 35/76 (46%), Gaps = 1/76 (1%)
 Frame = -3

Query: 226 HQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCP-DLFETLQIKGELSHQLVSNIIRQLCE 50
           H  +  HPN ++  F+  +I+ Q++ +    C   L         L  + + N+   + +
Sbjct: 153 HMNIPCHPNIVR--FHQAWIDKQILHIQLEMCDKSLAAYCHGIDWLEDKELWNVFLDILQ 210

Query: 49  ALNDLHKHNFIHNDIK 2
            L  LH +  +HNDIK
Sbjct: 211 GLGHLHNNFMLHNDIK 226


>U88311-7|AAB42348.1| 1173|Caenorhabditis elegans Lethal protein 502
           protein.
          Length = 1173

 Score = 30.3 bits (65), Expect = 1.7
 Identities = 17/51 (33%), Positives = 26/51 (50%)
 Frame = -3

Query: 154 IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           +VM+Y+   DL   L    E+S +       ++ EAL  LH   +IH D+K
Sbjct: 143 MVMEYMPGGDLVN-LMTSYEVSEKWTRFYTAEIVEALAALHSMGYIHRDVK 192


>U88178-7|ABA03111.1|  439|Caenorhabditis elegans Hypothetical
           protein W09C3.1 protein.
          Length = 439

 Score = 30.3 bits (65), Expect = 1.7
 Identities = 24/88 (27%), Positives = 42/88 (47%), Gaps = 2/88 (2%)
 Frame = -3

Query: 259 GANFNVDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQ- 83
           G N    E ++   M   P  I IY +  + + + IVM     PDL +  ++     +Q 
Sbjct: 69  GDNLLKFEREIMVAMQHEPTAIHIYDDGIYKDYRYIVMTLCG-PDLQKIAELMNNNFNQD 127

Query: 82  -LVSNIIRQLCEALNDLHKHNFIHNDIK 2
            ++   IR L  A+  +H++ +IH D+K
Sbjct: 128 TIIRVCIRTLL-AIKTMHEYTYIHRDLK 154


>U85515-1|AAB42081.1| 1173|Caenorhabditis elegans LET-502 protein.
          Length = 1173

 Score = 30.3 bits (65), Expect = 1.7
 Identities = 17/51 (33%), Positives = 26/51 (50%)
 Frame = -3

Query: 154 IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           +VM+Y+   DL   L    E+S +       ++ EAL  LH   +IH D+K
Sbjct: 143 MVMEYMPGGDLVN-LMTSYEVSEKWTRFYTAEIVEALAALHSMGYIHRDVK 192


>AY130758-5|AAN61521.1| 2693|Caenorhabditis elegans 301KDa_2 protein
           protein.
          Length = 2693

 Score = 30.3 bits (65), Expect = 1.7
 Identities = 14/70 (20%), Positives = 35/70 (50%), Gaps = 1/70 (1%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFET-LQIKGELSHQLVSNIIRQLCEALNDLH 32
           H   + ++      N   ++ +++   +LFE  L+    +S + V + + Q+   ++ +H
Sbjct: 162 HEKLLNLHEAFDMGNEMWLIEEFVSGGELFEKILEDDSLMSEEEVRDYMHQILLGVSHMH 221

Query: 31  KHNFIHNDIK 2
           K+  +H D+K
Sbjct: 222 KNQIVHLDLK 231


>AY130758-4|AAN61520.1| 2708|Caenorhabditis elegans 301KDa_1 protein
           protein.
          Length = 2708

 Score = 30.3 bits (65), Expect = 1.7
 Identities = 14/70 (20%), Positives = 35/70 (50%), Gaps = 1/70 (1%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFET-LQIKGELSHQLVSNIIRQLCEALNDLH 32
           H   + ++      N   ++ +++   +LFE  L+    +S + V + + Q+   ++ +H
Sbjct: 162 HEKLLNLHEAFDMGNEMWLIEEFVSGGELFEKILEDDSLMSEEEVRDYMHQILLGVSHMH 221

Query: 31  KHNFIHNDIK 2
           K+  +H D+K
Sbjct: 222 KNQIVHLDLK 231


>AY130758-2|AAN61518.1| 18519|Caenorhabditis elegans 2MDa_2 protein
             protein.
          Length = 18519

 Score = 30.3 bits (65), Expect = 1.7
 Identities = 14/70 (20%), Positives = 35/70 (50%), Gaps = 1/70 (1%)
 Frame = -3

Query: 208   HPNFIKIYFNHGFINNQVIVMDYIDCPDLFET-LQIKGELSHQLVSNIIRQLCEALNDLH 32
             H   + ++      N   ++ +++   +LFE  L+    +S + V + + Q+   ++ +H
Sbjct: 15988 HEKLLNLHEAFDMGNEMWLIEEFVSGGELFEKILEDDSLMSEEEVRDYMHQILLGVSHMH 16047

Query: 31    KHNFIHNDIK 2
             K+  +H D+K
Sbjct: 16048 KNQIVHLDLK 16057


>AY130758-1|AAN61517.1| 18534|Caenorhabditis elegans 2MDa_1 protein
             protein.
          Length = 18534

 Score = 30.3 bits (65), Expect = 1.7
 Identities = 14/70 (20%), Positives = 35/70 (50%), Gaps = 1/70 (1%)
 Frame = -3

Query: 208   HPNFIKIYFNHGFINNQVIVMDYIDCPDLFET-LQIKGELSHQLVSNIIRQLCEALNDLH 32
             H   + ++      N   ++ +++   +LFE  L+    +S + V + + Q+   ++ +H
Sbjct: 15988 HEKLLNLHEAFDMGNEMWLIEEFVSGGELFEKILEDDSLMSEEEVRDYMHQILLGVSHMH 16047

Query: 31    KHNFIHNDIK 2
             K+  +H D+K
Sbjct: 16048 KNQIVHLDLK 16057


>AF083878-1|AAD48898.1|  342|Caenorhabditis elegans cyclin-dependent
           kinase CDK-4 protein.
          Length = 342

 Score = 30.3 bits (65), Expect = 1.7
 Identities = 32/104 (30%), Positives = 48/104 (46%), Gaps = 9/104 (8%)
 Frame = -3

Query: 286 QIVFAENNFGANFNV-DEIKV--HQLMNDHPNFI--KIYFNHGFINNQVIVMDYI--DCP 128
           QI+ +  N G   +V  EI V  H     HPN I  K  F+       ++ ++ I   C 
Sbjct: 68  QIMISSKNEGIPQSVLREITVMKHLARKAHPNIISLKSVFHQLDPVRAILKINMIMERCD 127

Query: 127 -DLFETLQ-IKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
            DL   L+ I   +  Q   ++  Q+  AL+ LH H+ IH D+K
Sbjct: 128 WDLHTFLRNIPRGVPEQQAKHVTAQIVRALDFLHTHSIIHRDLK 171


>AC006676-2|AAK71382.3|  439|Caenorhabditis elegans Hypothetical
           protein M04F3.3 protein.
          Length = 439

 Score = 30.3 bits (65), Expect = 1.7
 Identities = 24/88 (27%), Positives = 42/88 (47%), Gaps = 2/88 (2%)
 Frame = -3

Query: 259 GANFNVDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQ- 83
           G N    E ++   M   P  I IY +  + + + IVM     PDL +  ++     +Q 
Sbjct: 69  GDNLLKIEREIMVAMQHEPTAIHIYDDGIYKDYRYIVMTLCG-PDLQKIAELMNNNFNQD 127

Query: 82  -LVSNIIRQLCEALNDLHKHNFIHNDIK 2
            ++   IR L  A+  +H++ +IH D+K
Sbjct: 128 TIIRVCIRTLL-AIKTMHEYTYIHRDLK 154


>Z73103-5|CAA97422.1|  380|Caenorhabditis elegans Hypothetical
           protein C08F8.6 protein.
          Length = 380

 Score = 29.9 bits (64), Expect = 2.3
 Identities = 11/24 (45%), Positives = 16/24 (66%)
 Frame = -3

Query: 73  NIIRQLCEALNDLHKHNFIHNDIK 2
           +I RQ  EAL D+H   ++H D+K
Sbjct: 116 SIARQSLEALEDMHNIGYLHRDVK 139


>Z49131-2|CAA88975.1|  321|Caenorhabditis elegans Hypothetical
           protein ZC373.3 protein.
          Length = 321

 Score = 29.9 bits (64), Expect = 2.3
 Identities = 21/81 (25%), Positives = 38/81 (46%), Gaps = 1/81 (1%)
 Frame = -3

Query: 241 DEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIK-GELSHQLVSNII 65
           +EI+  +  +D PN   ++ +   +   V+VM   +  +L E  +   G  S   +  I 
Sbjct: 84  NEIEFFKYCHDAPNIPTLFHHFSHVGFNVLVMSE-EGQNLREVAKRSPGSFSLNNLIRIA 142

Query: 64  RQLCEALNDLHKHNFIHNDIK 2
            Q+   L  +H  +FIH D+K
Sbjct: 143 YQIGSTLCFIHDKSFIHRDLK 163


>U97196-6|AAB52455.1|  373|Caenorhabditis elegans Hypothetical
           protein B0207.7 protein.
          Length = 373

 Score = 29.9 bits (64), Expect = 2.3
 Identities = 25/85 (29%), Positives = 35/85 (41%), Gaps = 5/85 (5%)
 Frame = -3

Query: 241 DEIKVHQLMNDHPNFIKIYFNHGFINN--QVIVMDYIDCPDLFETLQIKGELSHQLVSNI 68
           +E  + +L+   P F ++Y       N  QV +M    C      L+      H   S  
Sbjct: 62  NEAHILRLLQWSPGFCRLYTAKRLTWNKQQVNIMAMSLCARPISRLRRMMPDKHFSKSTA 121

Query: 67  IR---QLCEALNDLHKHNFIHNDIK 2
            R   QL EAL D+H    IH D+K
Sbjct: 122 ARLSVQLLEALRDMHASGIIHRDVK 146


>U88172-11|AAB42257.1|  390|Caenorhabditis elegans Hypothetical
           protein ZK354.2a protein.
          Length = 390

 Score = 29.9 bits (64), Expect = 2.3
 Identities = 11/24 (45%), Positives = 16/24 (66%)
 Frame = -3

Query: 73  NIIRQLCEALNDLHKHNFIHNDIK 2
           ++  Q   A+ DLH++ FIH DIK
Sbjct: 123 HLAEQTLTAIRDLHRNGFIHRDIK 146


>U88172-10|AAM97988.1|  437|Caenorhabditis elegans Hypothetical
           protein ZK354.2b protein.
          Length = 437

 Score = 29.9 bits (64), Expect = 2.3
 Identities = 11/24 (45%), Positives = 16/24 (66%)
 Frame = -3

Query: 73  NIIRQLCEALNDLHKHNFIHNDIK 2
           ++  Q   A+ DLH++ FIH DIK
Sbjct: 123 HLAEQTLTAIRDLHRNGFIHRDIK 146


>AF475094-1|AAL84635.1|  533|Caenorhabditis elegans SRC-1 protein.
          Length = 533

 Score = 29.9 bits (64), Expect = 2.3
 Identities = 17/70 (24%), Positives = 32/70 (45%), Gaps = 1/70 (1%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGE-LSHQLVSNIIRQLCEALNDL 35
           DHPN +K+Y          I+ +Y+    L + L+  G  L  Q + ++  Q+   +  L
Sbjct: 313 DHPNLVKLYAVCTREEPFYIITEYMINGSLLQYLRTDGSTLGIQALVDMAAQIANGMMYL 372

Query: 34  HKHNFIHNDI 5
            +   +H D+
Sbjct: 373 EERKLVHRDL 382


>AF419171-1|AAN31394.1|  533|Caenorhabditis elegans protein tyrosine
           kinase protein.
          Length = 533

 Score = 29.9 bits (64), Expect = 2.3
 Identities = 17/70 (24%), Positives = 32/70 (45%), Gaps = 1/70 (1%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGE-LSHQLVSNIIRQLCEALNDL 35
           DHPN +K+Y          I+ +Y+    L + L+  G  L  Q + ++  Q+   +  L
Sbjct: 313 DHPNLVKLYAVCTREEPFYIITEYMINGSLLQYLRTDGSTLGIQALVDMAAQIANGMMYL 372

Query: 34  HKHNFIHNDI 5
            +   +H D+
Sbjct: 373 EERKLVHRDL 382


>AC084161-5|AAK29735.4|  533|Caenorhabditis elegans Src oncogene
           related protein 1 protein.
          Length = 533

 Score = 29.9 bits (64), Expect = 2.3
 Identities = 17/70 (24%), Positives = 32/70 (45%), Gaps = 1/70 (1%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGE-LSHQLVSNIIRQLCEALNDL 35
           DHPN +K+Y          I+ +Y+    L + L+  G  L  Q + ++  Q+   +  L
Sbjct: 313 DHPNLVKLYAVCTREEPFYIITEYMINGSLLQYLRTDGSTLGIQALVDMAAQIANGMMYL 372

Query: 34  HKHNFIHNDI 5
            +   +H D+
Sbjct: 373 EERKLVHRDL 382


>AC024844-8|AAK29951.1|  421|Caenorhabditis elegans Hypothetical
           protein Y65B4A.9 protein.
          Length = 421

 Score = 29.9 bits (64), Expect = 2.3
 Identities = 11/24 (45%), Positives = 16/24 (66%)
 Frame = -3

Query: 73  NIIRQLCEALNDLHKHNFIHNDIK 2
           ++  Q   A+ DLH++ FIH DIK
Sbjct: 123 HLAEQTLAAIRDLHRNGFIHRDIK 146


>AC006615-7|AAK68227.1|  450|Caenorhabditis elegans Hypothetical
           protein C36B7.1 protein.
          Length = 450

 Score = 29.9 bits (64), Expect = 2.3
 Identities = 19/79 (24%), Positives = 40/79 (50%), Gaps = 1/79 (1%)
 Frame = -3

Query: 235 IKVHQL-MNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           +++HQL   ++ N +++     F  +  IV++     DL   L  + +L+ +    +I+ 
Sbjct: 177 LRIHQLNRQNNSNCVRMLDYDHFRGHHFIVLENYQT-DLASYLCGRSKLTPREYIPMIKS 235

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +   L  LH++  IH D+K
Sbjct: 236 IVHGLKFLHQNKIIHGDLK 254


>Z79598-5|CAB01863.1|  367|Caenorhabditis elegans Hypothetical
           protein C44H4.6 protein.
          Length = 367

 Score = 29.5 bits (63), Expect = 3.0
 Identities = 21/76 (27%), Positives = 35/76 (46%), Gaps = 6/76 (7%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVI--VMDYIDCPDLFETLQIKGELSHQLVSNIIR----QLCE 50
           DHPN I++ + +       +  VM+++   DL    +       Q+ +  I+    QL  
Sbjct: 86  DHPNIIRLLYYYVMQQENCLNFVMEFMP-KDLAYVHRQFAHNDKQMPAYSIKLYMFQLLR 144

Query: 49  ALNDLHKHNFIHNDIK 2
            +  LH HN +H DIK
Sbjct: 145 GIGFLHLHNIVHRDIK 160


>Z66523-1|CAA91411.1|  361|Caenorhabditis elegans Hypothetical
           protein M05D6.1 protein.
          Length = 361

 Score = 29.5 bits (63), Expect = 3.0
 Identities = 10/20 (50%), Positives = 15/20 (75%)
 Frame = -3

Query: 61  QLCEALNDLHKHNFIHNDIK 2
           QL +AL D+H+  F+H D+K
Sbjct: 125 QLVKALQDMHEAGFVHRDVK 144


>Z49966-3|CAA90241.1|  361|Caenorhabditis elegans Hypothetical
           protein F35C11.3 protein.
          Length = 361

 Score = 29.5 bits (63), Expect = 3.0
 Identities = 10/20 (50%), Positives = 15/20 (75%)
 Frame = -3

Query: 61  QLCEALNDLHKHNFIHNDIK 2
           QL +AL D+H+  F+H D+K
Sbjct: 125 QLVKALQDMHEAGFVHRDVK 144


>U58754-7|AAB00674.1|  308|Caenorhabditis elegans Hypothetical
           protein C39H7.1 protein.
          Length = 308

 Score = 29.5 bits (63), Expect = 3.0
 Identities = 27/94 (28%), Positives = 43/94 (45%), Gaps = 8/94 (8%)
 Frame = -3

Query: 259 GANFNVDEIKVH-QLMND-----HPNFIKIYFNHGFINNQVIVMDYI--DCPDLFETLQI 104
           GAN  +  +K+   ++N+     + +F KI     F N   +VM  +     DL +   +
Sbjct: 47  GANEQIQVLKLEVSVLNELSKRGNRHFCKIEDKGRFGNFNYVVMTLVGKSLQDLNKA-GV 105

Query: 103 KGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
            G +S      I  Q  EAL DLH   ++H D+K
Sbjct: 106 GGHMSMGCSIGIGIQSLEALEDLHNIGYLHRDVK 139


>U44902-1|AAA93318.1|  483|Caenorhabditis elegans serine/threonine
           kinase protein.
          Length = 483

 Score = 29.5 bits (63), Expect = 3.0
 Identities = 16/69 (23%), Positives = 31/69 (44%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           H N I++           + ++Y D  +LF+ ++    +S        +QL   L  +H 
Sbjct: 84  HDNVIRMIGMRNDPQFYYLFLEYADGGELFDKIEPDCGMSPVFAQFYFKQLICGLKFIHD 143

Query: 28  HNFIHNDIK 2
           ++ +H DIK
Sbjct: 144 NDVVHRDIK 152


>U41994-13|AAK31527.2| 1425|Caenorhabditis elegans Neuronal symmetry
           protein 1 protein.
          Length = 1425

 Score = 29.5 bits (63), Expect = 3.0
 Identities = 21/87 (24%), Positives = 43/87 (49%), Gaps = 6/87 (6%)
 Frame = -3

Query: 244 VDEIKVHQLMNDHPNFIK-----IYFNHGFINNQVIVMDYIDCPDLFETLQIK-GELSHQ 83
           ++EI +H  +  H N ++     +    G  ++ +I M+++    L   L+ K G ++  
Sbjct: 707 MEEISLHSTLC-HANIVQYLGCDLVGKDGSNDHFLIFMEHVPGGSLSSLLRSKWGPMNEN 765

Query: 82  LVSNIIRQLCEALNDLHKHNFIHNDIK 2
            ++   +Q+ E L  LH+   +H DIK
Sbjct: 766 AMNYYGKQILEGLKYLHELKIVHRDIK 792


>AL117202-13|CAB55075.1|  580|Caenorhabditis elegans Hypothetical
           protein Y47D3A.16 protein.
          Length = 580

 Score = 29.5 bits (63), Expect = 3.0
 Identities = 11/51 (21%), Positives = 27/51 (52%)
 Frame = -3

Query: 154 IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           ++++Y+   +LF  L+ +G     +    + ++  +L  LH+   I+ D+K
Sbjct: 162 LILEYLSGGELFMHLEREGMFMENVAKFYLSEIVVSLEHLHQQGIIYRDLK 212


>AL032634-2|CAC35855.1|  276|Caenorhabditis elegans Hypothetical
           protein Y39G8C.2 protein.
          Length = 276

 Score = 29.5 bits (63), Expect = 3.0
 Identities = 11/23 (47%), Positives = 15/23 (65%)
 Frame = -3

Query: 70  IIRQLCEALNDLHKHNFIHNDIK 2
           +  Q  EA+ DLH+  FIH D+K
Sbjct: 128 VASQCLEAVEDLHRTGFIHRDLK 150


>AL021566-2|CAA16502.1|  283|Caenorhabditis elegans Hypothetical
           protein F08E10.2 protein.
          Length = 283

 Score = 29.5 bits (63), Expect = 3.0
 Identities = 13/42 (30%), Positives = 25/42 (59%)
 Frame = -1

Query: 480 IVPIIE*IRLYRFIFTIRHGHHHRHKCTLQTLVQFYENCKNV 355
           +V +I   R++   F I + H+HRHK +++ ++ F+  C  V
Sbjct: 98  LVFVINLDRIFATYFPILY-HNHRHKISIRAILSFFLGCSLV 138


>AF098992-12|AAC67453.2|  328|Caenorhabditis elegans Hypothetical
           protein F53C3.1 protein.
          Length = 328

 Score = 29.5 bits (63), Expect = 3.0
 Identities = 11/20 (55%), Positives = 14/20 (70%)
 Frame = -3

Query: 61  QLCEALNDLHKHNFIHNDIK 2
           Q  EA+ +LHK  FIH D+K
Sbjct: 131 QCLEAVEELHKQGFIHRDLK 150


>AC024770-6|AAF59485.2|  503|Caenorhabditis elegans Checkpoint
           kinase protein 1, isoforma protein.
          Length = 503

 Score = 29.5 bits (63), Expect = 3.0
 Identities = 16/69 (23%), Positives = 31/69 (44%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           H N I++           + ++Y D  +LF+ ++    +S        +QL   L  +H 
Sbjct: 84  HDNVIRMIGMRNDPQFYYLFLEYADGGELFDKIEPDCGMSPVFAQFYFKQLICGLKFIHD 143

Query: 28  HNFIHNDIK 2
           ++ +H DIK
Sbjct: 144 NDVVHRDIK 152


>Z68104-8|CAA92117.1| 1077|Caenorhabditis elegans Hypothetical
           protein F46C3.1 protein.
          Length = 1077

 Score = 29.1 bits (62), Expect = 3.9
 Identities = 12/26 (46%), Positives = 15/26 (57%)
 Frame = -3

Query: 79  VSNIIRQLCEALNDLHKHNFIHNDIK 2
           + N I+QL   L  LH   FIH D+K
Sbjct: 910 MKNWIKQLASGLEYLHNKGFIHRDLK 935


>Z66563-4|CAA91470.1| 1077|Caenorhabditis elegans Hypothetical
           protein F46C3.1 protein.
          Length = 1077

 Score = 29.1 bits (62), Expect = 3.9
 Identities = 12/26 (46%), Positives = 15/26 (57%)
 Frame = -3

Query: 79  VSNIIRQLCEALNDLHKHNFIHNDIK 2
           + N I+QL   L  LH   FIH D+K
Sbjct: 910 MKNWIKQLASGLEYLHNKGFIHRDLK 935


>Z50029-6|CAD57714.1| 1072|Caenorhabditis elegans Hypothetical
           protein ZC504.4d protein.
          Length = 1072

 Score = 29.1 bits (62), Expect = 3.9
 Identities = 12/33 (36%), Positives = 18/33 (54%)
 Frame = -3

Query: 100 GELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           G L  + ++ I R++   L  LH+   IH DIK
Sbjct: 121 GSLKEEWIAYICREILRGLYHLHQSKVIHRDIK 153


>Z50029-5|CAC42384.1| 1096|Caenorhabditis elegans Hypothetical
           protein ZC504.4c protein.
          Length = 1096

 Score = 29.1 bits (62), Expect = 3.9
 Identities = 12/33 (36%), Positives = 18/33 (54%)
 Frame = -3

Query: 100 GELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           G L  + ++ I R++   L  LH+   IH DIK
Sbjct: 121 GSLKEEWIAYICREILRGLYHLHQSKVIHRDIK 153


>Z50029-4|CAB63417.1| 1082|Caenorhabditis elegans Hypothetical
           protein ZC504.4b protein.
          Length = 1082

 Score = 29.1 bits (62), Expect = 3.9
 Identities = 12/33 (36%), Positives = 18/33 (54%)
 Frame = -3

Query: 100 GELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           G L  + ++ I R++   L  LH+   IH DIK
Sbjct: 121 GSLKEEWIAYICREILRGLYHLHQSKVIHRDIK 153


>Z50029-3|CAB63416.1| 1087|Caenorhabditis elegans Hypothetical
           protein ZC504.4a protein.
          Length = 1087

 Score = 29.1 bits (62), Expect = 3.9
 Identities = 12/33 (36%), Positives = 18/33 (54%)
 Frame = -3

Query: 100 GELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           G L  + ++ I R++   L  LH+   IH DIK
Sbjct: 121 GSLKEEWIAYICREILRGLYHLHQSKVIHRDIK 153


>Z49132-8|CAA88987.1|  366|Caenorhabditis elegans Hypothetical
           protein ZK666.8 protein.
          Length = 366

 Score = 29.1 bits (62), Expect = 3.9
 Identities = 14/32 (43%), Positives = 17/32 (53%)
 Frame = -3

Query: 97  ELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           +LS   V  I  Q   AL DLH   ++H DIK
Sbjct: 162 KLSKSSVGRIAVQAIAALRDLHDVGYLHRDIK 193


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,997,975
Number of Sequences: 27780
Number of extensions: 358678
Number of successful extensions: 1771
Number of sequences better than 10.0: 315
Number of HSP's better than 10.0 without gapping: 1601
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1743
length of database: 12,740,198
effective HSP length: 80
effective length of database: 10,517,798
effective search space used: 1987863822
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -