SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120042.Seq
         (745 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z71266-12|CAA95848.1| 1938|Caenorhabditis elegans Hypothetical p...    29   3.5  
Z71261-8|CAA95806.1| 1938|Caenorhabditis elegans Hypothetical pr...    29   3.5  
X08065-1|CAA30854.1| 1938|Caenorhabditis elegans myosin 1 protein.     29   3.5  
M37232-1|AAA28119.1|  251|Caenorhabditis elegans myosin I protein.     29   3.5  
Z73425-2|CAA97788.1| 1126|Caenorhabditis elegans Hypothetical pr...    29   4.6  
Z83107-10|CAB05505.1| 1963|Caenorhabditis elegans Hypothetical p...    28   6.1  
Z81499-3|CAB04089.1| 1963|Caenorhabditis elegans Hypothetical pr...    28   6.1  
Z70207-8|CAM33501.1|  835|Caenorhabditis elegans Hypothetical pr...    28   6.1  
Z70207-5|CAA94127.2|  914|Caenorhabditis elegans Hypothetical pr...    28   6.1  
Z68119-8|CAA92197.2| 1947|Caenorhabditis elegans Hypothetical pr...    28   6.1  
Z68117-6|CAA92183.2| 1947|Caenorhabditis elegans Hypothetical pr...    28   6.1  
Z11126-2|CAA77473.1|  197|Caenorhabditis elegans Hypothetical pr...    28   6.1  
X08066-1|CAA30855.1| 1947|Caenorhabditis elegans myosin heavy ch...    28   6.1  
M37233-1|AAA28121.1|  260|Caenorhabditis elegans myosin II protein.    28   6.1  
J01050-1|AAA28124.1| 1966|Caenorhabditis elegans myosin heavy ch...    28   6.1  
AF316542-1|AAG50270.1|  914|Caenorhabditis elegans serine/threon...    28   6.1  
Z81117-8|CAB03316.2|  334|Caenorhabditis elegans Hypothetical pr...    28   8.0  

>Z71266-12|CAA95848.1| 1938|Caenorhabditis elegans Hypothetical
           protein R06C7.10 protein.
          Length = 1938

 Score = 29.1 bits (62), Expect = 3.5
 Identities = 17/52 (32%), Positives = 27/52 (51%)
 Frame = -1

Query: 607 SFDNVRALRQNNGPKFGIN*IDIHAVRYQNVLVSASLPMYLMTVSMMIFKTP 452
           +F N + +R NN  +FG   I IH  ++   L S  +  YL+  S +I + P
Sbjct: 227 AFGNAKTVRNNNSSRFG-KFIRIHFNKH-GTLASCDIEHYLLEKSRVIRQAP 276


>Z71261-8|CAA95806.1| 1938|Caenorhabditis elegans Hypothetical
           protein R06C7.10 protein.
          Length = 1938

 Score = 29.1 bits (62), Expect = 3.5
 Identities = 17/52 (32%), Positives = 27/52 (51%)
 Frame = -1

Query: 607 SFDNVRALRQNNGPKFGIN*IDIHAVRYQNVLVSASLPMYLMTVSMMIFKTP 452
           +F N + +R NN  +FG   I IH  ++   L S  +  YL+  S +I + P
Sbjct: 227 AFGNAKTVRNNNSSRFG-KFIRIHFNKH-GTLASCDIEHYLLEKSRVIRQAP 276


>X08065-1|CAA30854.1| 1938|Caenorhabditis elegans myosin 1 protein.
          Length = 1938

 Score = 29.1 bits (62), Expect = 3.5
 Identities = 17/52 (32%), Positives = 27/52 (51%)
 Frame = -1

Query: 607 SFDNVRALRQNNGPKFGIN*IDIHAVRYQNVLVSASLPMYLMTVSMMIFKTP 452
           +F N + +R NN  +FG   I IH  ++   L S  +  YL+  S +I + P
Sbjct: 227 AFGNAKTVRNNNSSRFG-KFIRIHFNKH-GTLASCDIEHYLLEKSRVIRQAP 276


>M37232-1|AAA28119.1|  251|Caenorhabditis elegans myosin I protein.
          Length = 251

 Score = 29.1 bits (62), Expect = 3.5
 Identities = 17/52 (32%), Positives = 27/52 (51%)
 Frame = -1

Query: 607 SFDNVRALRQNNGPKFGIN*IDIHAVRYQNVLVSASLPMYLMTVSMMIFKTP 452
           +F N + +R NN  +FG   I IH  ++   L S  +  YL+  S +I + P
Sbjct: 113 AFGNAKTVRNNNSSRFG-KFIRIHFNKH-GTLASCDIEHYLLEKSRVIRQAP 162


>Z73425-2|CAA97788.1| 1126|Caenorhabditis elegans Hypothetical protein
            F12F6.6 protein.
          Length = 1126

 Score = 28.7 bits (61), Expect = 4.6
 Identities = 22/82 (26%), Positives = 37/82 (45%), Gaps = 3/82 (3%)
 Frame = +3

Query: 180  DTSSTSELQSNAST*QLFRSR*RKRMLHMTVLNSVFLNEHAKL---YYRHLLRNDQAEAR 350
            D  S+   +S +S    F +  R++      L  + L E  KL   Y   +L+ND     
Sbjct: 890  DKGSSEMRESLSSRCAQFLATYREKCSEGAPLGQLILPESLKLMPLYVNSILKNDAISGG 949

Query: 351  KTILNADDVYECVLIKPIRTEH 416
              +   D V++  LI+ +RTE+
Sbjct: 950  SEMTVDDKVWQMELIRGLRTEN 971


>Z83107-10|CAB05505.1| 1963|Caenorhabditis elegans Hypothetical
           protein F11C3.3 protein.
          Length = 1963

 Score = 28.3 bits (60), Expect = 6.1
 Identities = 17/52 (32%), Positives = 27/52 (51%)
 Frame = -1

Query: 607 SFDNVRALRQNNGPKFGIN*IDIHAVRYQNVLVSASLPMYLMTVSMMIFKTP 452
           +F N + +R NN  +FG   I IH  ++   L S  +  YL+  S +I + P
Sbjct: 227 AFGNAKTVRNNNSSRFG-KFIRIHFNKHGR-LASCDIEHYLLEKSRVIRQAP 276


>Z81499-3|CAB04089.1| 1963|Caenorhabditis elegans Hypothetical
           protein F11C3.3 protein.
          Length = 1963

 Score = 28.3 bits (60), Expect = 6.1
 Identities = 17/52 (32%), Positives = 27/52 (51%)
 Frame = -1

Query: 607 SFDNVRALRQNNGPKFGIN*IDIHAVRYQNVLVSASLPMYLMTVSMMIFKTP 452
           +F N + +R NN  +FG   I IH  ++   L S  +  YL+  S +I + P
Sbjct: 227 AFGNAKTVRNNNSSRFG-KFIRIHFNKHGR-LASCDIEHYLLEKSRVIRQAP 276


>Z70207-8|CAM33501.1|  835|Caenorhabditis elegans Hypothetical
           protein F15A2.6b protein.
          Length = 835

 Score = 28.3 bits (60), Expect = 6.1
 Identities = 13/36 (36%), Positives = 21/36 (58%)
 Frame = +2

Query: 614 AESDSESGQSVDVCNELQYPWNLITANSFNVSTDES 721
           AESDSE  Q +D  + ++  W    A+S +V  D++
Sbjct: 617 AESDSEDSQMIDTTDLVKKSWFGSLASSMSVERDDT 652


>Z70207-5|CAA94127.2|  914|Caenorhabditis elegans Hypothetical
           protein F15A2.6a protein.
          Length = 914

 Score = 28.3 bits (60), Expect = 6.1
 Identities = 13/36 (36%), Positives = 21/36 (58%)
 Frame = +2

Query: 614 AESDSESGQSVDVCNELQYPWNLITANSFNVSTDES 721
           AESDSE  Q +D  + ++  W    A+S +V  D++
Sbjct: 617 AESDSEDSQMIDTTDLVKKSWFGSLASSMSVERDDT 652


>Z68119-8|CAA92197.2| 1947|Caenorhabditis elegans Hypothetical
           protein T18D3.4 protein.
          Length = 1947

 Score = 28.3 bits (60), Expect = 6.1
 Identities = 17/52 (32%), Positives = 27/52 (51%)
 Frame = -1

Query: 607 SFDNVRALRQNNGPKFGIN*IDIHAVRYQNVLVSASLPMYLMTVSMMIFKTP 452
           +F N + +R NN  +FG   I IH  + Q  + S  +  YL+  S +I + P
Sbjct: 233 AFGNAKTVRNNNSSRFG-KFIRIHFSK-QGRVASCDIEHYLLEKSRVIRQAP 282


>Z68117-6|CAA92183.2| 1947|Caenorhabditis elegans Hypothetical
           protein T18D3.4 protein.
          Length = 1947

 Score = 28.3 bits (60), Expect = 6.1
 Identities = 17/52 (32%), Positives = 27/52 (51%)
 Frame = -1

Query: 607 SFDNVRALRQNNGPKFGIN*IDIHAVRYQNVLVSASLPMYLMTVSMMIFKTP 452
           +F N + +R NN  +FG   I IH  + Q  + S  +  YL+  S +I + P
Sbjct: 233 AFGNAKTVRNNNSSRFG-KFIRIHFSK-QGRVASCDIEHYLLEKSRVIRQAP 282


>Z11126-2|CAA77473.1|  197|Caenorhabditis elegans Hypothetical
           protein ZK643.2 protein.
          Length = 197

 Score = 28.3 bits (60), Expect = 6.1
 Identities = 12/40 (30%), Positives = 22/40 (55%)
 Frame = +2

Query: 485 QVHWQTGRDEYILIADRMYVDLIYSEFRAIILPQSAYIIK 604
           +V++   RDE    A +  +D     +  I++PQ AY+I+
Sbjct: 157 KVYFLENRDELAFRASKKMLDHARLPYEQIVMPQEAYVIE 196


>X08066-1|CAA30855.1| 1947|Caenorhabditis elegans myosin heavy chain
           2 protein.
          Length = 1947

 Score = 28.3 bits (60), Expect = 6.1
 Identities = 17/52 (32%), Positives = 27/52 (51%)
 Frame = -1

Query: 607 SFDNVRALRQNNGPKFGIN*IDIHAVRYQNVLVSASLPMYLMTVSMMIFKTP 452
           +F N + +R NN  +FG   I IH  + Q  + S  +  YL+  S +I + P
Sbjct: 233 AFGNAKTVRNNNSSRFG-KFIRIHFSK-QGRVASCDIEHYLLEKSRVIRQAP 282


>M37233-1|AAA28121.1|  260|Caenorhabditis elegans myosin II protein.
          Length = 260

 Score = 28.3 bits (60), Expect = 6.1
 Identities = 17/52 (32%), Positives = 27/52 (51%)
 Frame = -1

Query: 607 SFDNVRALRQNNGPKFGIN*IDIHAVRYQNVLVSASLPMYLMTVSMMIFKTP 452
           +F N + +R NN  +FG   I IH  + Q  + S  +  YL+  S +I + P
Sbjct: 122 AFGNAKTVRNNNSSRFG-KFIRIHFSK-QGRVASCDIEHYLLEKSRVIRQAP 171


>J01050-1|AAA28124.1| 1966|Caenorhabditis elegans myosin heavy chain
           protein.
          Length = 1966

 Score = 28.3 bits (60), Expect = 6.1
 Identities = 17/52 (32%), Positives = 27/52 (51%)
 Frame = -1

Query: 607 SFDNVRALRQNNGPKFGIN*IDIHAVRYQNVLVSASLPMYLMTVSMMIFKTP 452
           +F N + +R NN  +FG   I IH  ++   L S  +  YL+  S +I + P
Sbjct: 230 AFGNAKTVRNNNSSRFG-KFIRIHFNKHGR-LASCDIEHYLLEKSRVIRQAP 279


>AF316542-1|AAG50270.1|  914|Caenorhabditis elegans serine/threonine
           kinase SAD-1 protein.
          Length = 914

 Score = 28.3 bits (60), Expect = 6.1
 Identities = 13/36 (36%), Positives = 21/36 (58%)
 Frame = +2

Query: 614 AESDSESGQSVDVCNELQYPWNLITANSFNVSTDES 721
           AESDSE  Q +D  + ++  W    A+S +V  D++
Sbjct: 617 AESDSEDSQMIDTTDLVKKSWFGSLASSMSVERDDT 652


>Z81117-8|CAB03316.2|  334|Caenorhabditis elegans Hypothetical
           protein T06E6.7 protein.
          Length = 334

 Score = 27.9 bits (59), Expect = 8.0
 Identities = 11/42 (26%), Positives = 22/42 (52%)
 Frame = -1

Query: 532 VRYQNVLVSASLPMYLMTVSMMIFKTPMLCSPASSTLLKCSV 407
           V Y + ++  SLP+ L ++  ++F+TP        +LL   +
Sbjct: 8   VHYVHAIIFVSLPVQLFSIYCILFETPKTMKSVKWSLLNARI 49


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,268,021
Number of Sequences: 27780
Number of extensions: 305223
Number of successful extensions: 868
Number of sequences better than 10.0: 17
Number of HSP's better than 10.0 without gapping: 853
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 868
length of database: 12,740,198
effective HSP length: 80
effective length of database: 10,517,798
effective search space used: 1756472266
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -