SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120040.Seq
         (757 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U40799-2|AAA81480.1|  712|Caenorhabditis elegans Hypothetical pr...    30   2.0  
Z82268-4|CAB05199.1|  741|Caenorhabditis elegans Hypothetical pr...    29   3.6  
U42436-12|AAF99901.1| 1206|Caenorhabditis elegans Guanylyl cycla...    29   3.6  
AB201388-1|BAE78828.1| 1152|Caenorhabditis elegans recepotor typ...    29   3.6  
Z81586-10|CAD56598.1|  349|Caenorhabditis elegans Hypothetical p...    29   4.7  
Z79757-3|CAC42307.1|  585|Caenorhabditis elegans Hypothetical pr...    29   4.7  
Z79757-2|CAB02129.2|  587|Caenorhabditis elegans Hypothetical pr...    29   4.7  
AL132952-8|CAB61142.2|  186|Caenorhabditis elegans Hypothetical ...    29   4.7  
AF022980-3|AAG24187.2|  396|Caenorhabditis elegans Serpentine re...    29   4.7  
AF020788-1|AAC47809.1|  587|Caenorhabditis elegans SEL-10 protein.     29   4.7  
AF016655-9|AAK31440.1|  348|Caenorhabditis elegans Hypothetical ...    29   4.7  
Z49127-11|CAA88952.2|  452|Caenorhabditis elegans Hypothetical p...    28   8.2  
U61944-5|AAB03121.2|  482|Caenorhabditis elegans Hypothetical pr...    28   8.2  
U28741-4|AAA68328.1|  747|Caenorhabditis elegans Hypothetical pr...    28   8.2  
AL033535-4|CAA22134.2|  452|Caenorhabditis elegans Hypothetical ...    28   8.2  

>U40799-2|AAA81480.1|  712|Caenorhabditis elegans Hypothetical
           protein F42C5.4 protein.
          Length = 712

 Score = 29.9 bits (64), Expect = 2.0
 Identities = 14/42 (33%), Positives = 25/42 (59%)
 Frame = +2

Query: 203 HDV*HFGSYTKRYAQEQHLRDRIKSKVDEQFDQLEREYSDKI 328
           H V  F +YT+   +E H++ R +S V++ F+ L R+  D +
Sbjct: 272 HFVKCFYTYTEPSDRESHVKGRWRSDVNKYFESLSRKNVDSV 313


>Z82268-4|CAB05199.1|  741|Caenorhabditis elegans Hypothetical
           protein F52B11.3 protein.
          Length = 741

 Score = 29.1 bits (62), Expect = 3.6
 Identities = 21/65 (32%), Positives = 35/65 (53%)
 Frame = +2

Query: 317 SDKIDGFHDNIQYFKDEHYSVSCQNGSVLKSKFAKILKSHDYTDKKSIETYEKYCLPQLV 496
           S+KID ++DN    +      S  N   +K+   +I + +D+T  +S+E  E YCL + +
Sbjct: 194 SEKID-YYDNNCLSRQNRCGPSGGNLVFVKTTNFEI-RYYDHT--QSVEAQESYCLQKCL 249

Query: 497 DKHNT 511
           D  NT
Sbjct: 250 DSLNT 254


>U42436-12|AAF99901.1| 1206|Caenorhabditis elegans Guanylyl cyclase
           protein 8 protein.
          Length = 1206

 Score = 29.1 bits (62), Expect = 3.6
 Identities = 12/34 (35%), Positives = 18/34 (52%)
 Frame = +1

Query: 556 SNQVLSFEYNPIGNKVIVPFAHEINDTGLYEYDV 657
           +N ++  + N   N ++ PF   I D GL E DV
Sbjct: 351 ANAIIIDDVNSFDNTIVGPFIERIKDVGLTEADV 384


>AB201388-1|BAE78828.1| 1152|Caenorhabditis elegans recepotor type
           guanyly cyclase protein.
          Length = 1152

 Score = 29.1 bits (62), Expect = 3.6
 Identities = 12/34 (35%), Positives = 18/34 (52%)
 Frame = +1

Query: 556 SNQVLSFEYNPIGNKVIVPFAHEINDTGLYEYDV 657
           +N ++  + N   N ++ PF   I D GL E DV
Sbjct: 325 ANAIIIDDVNSFDNTIVGPFIERIKDVGLTEADV 358


>Z81586-10|CAD56598.1|  349|Caenorhabditis elegans Hypothetical
           protein T05F1.13 protein.
          Length = 349

 Score = 28.7 bits (61), Expect = 4.7
 Identities = 13/38 (34%), Positives = 20/38 (52%)
 Frame = +2

Query: 293 FDQLEREYSDKIDGFHDNIQYFKDEHYSVSCQNGSVLK 406
           FD +E E  DK    +   Q+++DE   + C NG  +K
Sbjct: 291 FDGIEYELFDK--NLNSGTQFYEDEEKKIDCLNGRNIK 326


>Z79757-3|CAC42307.1|  585|Caenorhabditis elegans Hypothetical
           protein F55B12.3b protein.
          Length = 585

 Score = 28.7 bits (61), Expect = 4.7
 Identities = 14/39 (35%), Positives = 21/39 (53%)
 Frame = -1

Query: 199 TGFVNCVFIILLMYTNSLVCSST*QSRITVWDTSISTGK 83
           TG  N V+ +L     S+VCS +  + I VWD +   G+
Sbjct: 413 TGHNNRVYSLLFESERSIVCSGSLDTSIRVWDFTRPEGQ 451


>Z79757-2|CAB02129.2|  587|Caenorhabditis elegans Hypothetical
           protein F55B12.3a protein.
          Length = 587

 Score = 28.7 bits (61), Expect = 4.7
 Identities = 14/39 (35%), Positives = 21/39 (53%)
 Frame = -1

Query: 199 TGFVNCVFIILLMYTNSLVCSST*QSRITVWDTSISTGK 83
           TG  N V+ +L     S+VCS +  + I VWD +   G+
Sbjct: 415 TGHNNRVYSLLFESERSIVCSGSLDTSIRVWDFTRPEGQ 453


>AL132952-8|CAB61142.2|  186|Caenorhabditis elegans Hypothetical
           protein Y51H4A.8 protein.
          Length = 186

 Score = 28.7 bits (61), Expect = 4.7
 Identities = 15/44 (34%), Positives = 26/44 (59%)
 Frame = +1

Query: 613 FAHEINDTGLYEYDVLAYVDSVEFDGKQFEEFVQKLILPSSFND 744
           F++E+N   LY YD LA  ++ +FD + + + V    + S+ ND
Sbjct: 31  FSYEMNPPALYTYDSLAEFENGQFD-QAYAQRVVVSDVQSAIND 73


>AF022980-3|AAG24187.2|  396|Caenorhabditis elegans Serpentine
           receptor, class w protein2 protein.
          Length = 396

 Score = 28.7 bits (61), Expect = 4.7
 Identities = 20/79 (25%), Positives = 39/79 (49%), Gaps = 6/79 (7%)
 Frame = -1

Query: 535 STRIPPRSSVVFVDQLGQ-TVFFVSFNRL-----FIGIIMTF*NFSKLAFQHAAILATYR 374
           +T  PP+  V +V+        F+ FN +     F  + +   + S L  +    ++ YR
Sbjct: 15  TTAKPPKEIVKYVEIPSWFDEVFLKFNYVIAILQFFAVAINLIHLSVLTRKELRAISIYR 74

Query: 373 IVFIFKILDVIVKSINFIA 317
           I+ +  ILD+I + ++FI+
Sbjct: 75  IMIVICILDIISEILSFIS 93


>AF020788-1|AAC47809.1|  587|Caenorhabditis elegans SEL-10 protein.
          Length = 587

 Score = 28.7 bits (61), Expect = 4.7
 Identities = 14/39 (35%), Positives = 21/39 (53%)
 Frame = -1

Query: 199 TGFVNCVFIILLMYTNSLVCSST*QSRITVWDTSISTGK 83
           TG  N V+ +L     S+VCS +  + I VWD +   G+
Sbjct: 415 TGHNNRVYSLLFESERSIVCSGSLDTSIRVWDFTRPEGQ 453


>AF016655-9|AAK31440.1|  348|Caenorhabditis elegans Hypothetical
           protein C17F4.5 protein.
          Length = 348

 Score = 28.7 bits (61), Expect = 4.7
 Identities = 20/74 (27%), Positives = 30/74 (40%)
 Frame = +2

Query: 260 RDRIKSKVDEQFDQLEREYSDKIDGFHDNIQYFKDEHYSVSCQNGSVLKSKFAKILKSHD 439
           R  ++S  D   D   R      DG  +NI+   + HY  +  N  ++K  FA      D
Sbjct: 205 RIHLESADDYTVDDFMRLIEKWADGTTENIKTAGNFHYKFTLSNPELVKQVFALSEVLGD 264

Query: 440 YTDKKSIETYEKYC 481
              K  I+ + K C
Sbjct: 265 AGKKDPIKFFGKVC 278


>Z49127-11|CAA88952.2|  452|Caenorhabditis elegans Hypothetical
           protein F13D12.9 protein.
          Length = 452

 Score = 27.9 bits (59), Expect = 8.2
 Identities = 15/48 (31%), Positives = 23/48 (47%), Gaps = 1/48 (2%)
 Frame = +2

Query: 257 LRDRIKSKVDEQFDQLEREYSDKIDGFHDNIQYFKDEH-YSVSCQNGS 397
           L D +K   D  F +LE+    KID   D ++   D+H   + C  G+
Sbjct: 202 LFDEVKPVTDVDFVELEKAQYKKIDRLIDQLELKADDHVLEIGCGWGA 249


>U61944-5|AAB03121.2|  482|Caenorhabditis elegans Hypothetical
           protein T12E12.1 protein.
          Length = 482

 Score = 27.9 bits (59), Expect = 8.2
 Identities = 9/28 (32%), Positives = 20/28 (71%)
 Frame = +2

Query: 218 FGSYTKRYAQEQHLRDRIKSKVDEQFDQ 301
           F +++K    E+ LRD+I+ K+D++ ++
Sbjct: 362 FENHSKSLKMEEELRDKIRKKIDDKVNE 389


>U28741-4|AAA68328.1|  747|Caenorhabditis elegans Hypothetical
           protein F35D2.4 protein.
          Length = 747

 Score = 27.9 bits (59), Expect = 8.2
 Identities = 12/33 (36%), Positives = 19/33 (57%)
 Frame = -2

Query: 684 KLHTVHVS*DVVLVKSRVVNFVSKRHNNFVTNR 586
           KL+ VH+    V V  +++NF +K  N +V  R
Sbjct: 314 KLYPVHILNSAVRVNGQLLNFANKDRNRWVLTR 346


>AL033535-4|CAA22134.2|  452|Caenorhabditis elegans Hypothetical
           protein F13D12.9 protein.
          Length = 452

 Score = 27.9 bits (59), Expect = 8.2
 Identities = 15/48 (31%), Positives = 23/48 (47%), Gaps = 1/48 (2%)
 Frame = +2

Query: 257 LRDRIKSKVDEQFDQLEREYSDKIDGFHDNIQYFKDEH-YSVSCQNGS 397
           L D +K   D  F +LE+    KID   D ++   D+H   + C  G+
Sbjct: 202 LFDEVKPVTDVDFVELEKAQYKKIDRLIDQLELKADDHVLEIGCGWGA 249


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,951,606
Number of Sequences: 27780
Number of extensions: 367298
Number of successful extensions: 1132
Number of sequences better than 10.0: 15
Number of HSP's better than 10.0 without gapping: 1099
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1132
length of database: 12,740,198
effective HSP length: 80
effective length of database: 10,517,798
effective search space used: 1798543458
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -