SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120039.Seq
         (672 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U97012-3|AAK39144.2|  588|Caenorhabditis elegans Groundhog (hedg...    34   0.11 
Z81115-5|CAB03295.1|  482|Caenorhabditis elegans Hypothetical pr...    32   0.32 
Z46241-5|CAA86321.1|  279|Caenorhabditis elegans Hypothetical pr...    30   1.3  
Z82278-6|CAB05258.1|  690|Caenorhabditis elegans Hypothetical pr...    29   4.0  
U39649-3|AAM69070.1| 1538|Caenorhabditis elegans Hypothetical pr...    29   4.0  
U39649-2|AAM69069.1| 1534|Caenorhabditis elegans Hypothetical pr...    29   4.0  
Z93396-3|CAB07712.1|  597|Caenorhabditis elegans Hypothetical pr...    28   6.9  
Z83107-10|CAB05505.1| 1963|Caenorhabditis elegans Hypothetical p...    28   6.9  
Z81499-3|CAB04089.1| 1963|Caenorhabditis elegans Hypothetical pr...    28   6.9  
J01050-1|AAA28124.1| 1966|Caenorhabditis elegans myosin heavy ch...    28   6.9  

>U97012-3|AAK39144.2|  588|Caenorhabditis elegans Groundhog
           (hedgehog-like family)protein 9 protein.
          Length = 588

 Score = 33.9 bits (74), Expect = 0.11
 Identities = 16/40 (40%), Positives = 24/40 (60%)
 Frame = +3

Query: 165 KKTKAKPRAKNQQTLLDIIAKFNQGNKAKAKVPVTRAKKM 284
           + T  KP A +Q T+LD + +  Q NK   ++PV R KK+
Sbjct: 370 ESTTIKPNAVSQPTILDFVERSKQQNKL-MRIPVYRGKKL 408


>Z81115-5|CAB03295.1|  482|Caenorhabditis elegans Hypothetical
           protein T05D4.5 protein.
          Length = 482

 Score = 32.3 bits (70), Expect = 0.32
 Identities = 31/117 (26%), Positives = 55/117 (47%), Gaps = 9/117 (7%)
 Frame = +3

Query: 93  QADVNSLVHQYLEKIDKS-LAQTFMKKTKAKPRAKNQQTLLDIIA-----KFNQGNKAKA 254
           + D +    QY+ K+ K+  A++F KK KA+   +  + + +I A     K  +    +A
Sbjct: 246 EEDRDQFHFQYMRKVLKTDEAESFAKKLKAEKVERLDKKIDEIKARKIDEKLIEREIVRA 305

Query: 255 KVPVTRAKKMPLRNQQF---KQMGKFQQLRKKLKVQILVAPMMSHQNRHLSPTKQLK 416
           + P    K   LR ++F   ++  K  +  +KLKV     PM+SH +  +   K  K
Sbjct: 306 ESPKFEPKTRRLRVEKFFNQQKQKKENEWMEKLKVDASRKPMLSHWDLEMKNIKAEK 362


>Z46241-5|CAA86321.1|  279|Caenorhabditis elegans Hypothetical
           protein C38D4.7 protein.
          Length = 279

 Score = 30.3 bits (65), Expect = 1.3
 Identities = 25/120 (20%), Positives = 57/120 (47%), Gaps = 3/120 (2%)
 Frame = +3

Query: 108 SLVHQYLEKIDKSLAQTFMKKTKAKPRAKNQQTLLDI-IAKFNQGNKAK-AKVPVTRAKK 281
           +LVH  +E++D+S A ++    +  P + + +    +  A   Q N AK    PV  AK+
Sbjct: 136 ALVHSLVERVDRSHASSYDVVGQKNPSSSSLKPAKRVKSAVVRQSNLAKRTGAPVDAAKE 195

Query: 282 M-PLRNQQFKQMGKFQQLRKKLKVQILVAPMMSHQNRHLSPTKQLKNLTLHQLRNKNHQM 458
           +  +R+++ +  G+  + R  + +  ++    S  ++ L   K  +  T +++     Q+
Sbjct: 196 LKKIRDEENRNHGRSAE-RDNVFIGAVLVGKGSQYDKDLEKFKSFRCRTCNEVSQTKEQL 254


>Z82278-6|CAB05258.1|  690|Caenorhabditis elegans Hypothetical
           protein M162.7 protein.
          Length = 690

 Score = 28.7 bits (61), Expect = 4.0
 Identities = 13/35 (37%), Positives = 21/35 (60%)
 Frame = +3

Query: 249 KAKVPVTRAKKMPLRNQQFKQMGKFQQLRKKLKVQ 353
           K   P+ + +K+P   + FK++ KF +LRK L  Q
Sbjct: 216 KMSEPLEQLQKLPSVFEPFKEVSKFMRLRKTLPHQ 250


>U39649-3|AAM69070.1| 1538|Caenorhabditis elegans Hypothetical protein
            T23F2.2b protein.
          Length = 1538

 Score = 28.7 bits (61), Expect = 4.0
 Identities = 28/129 (21%), Positives = 68/129 (52%), Gaps = 4/129 (3%)
 Frame = +3

Query: 84   TEIQADVNSLVHQYLEKIDKSLAQTFMKKTKAKPRAKNQQTLLDIIAKFNQGNK----AK 251
            +++Q+ VN   H   +   +++ +   K    KP  KN++T+++  A F++  +     K
Sbjct: 810  SQLQSRVN---HSQRDVECQAIPRQINKYVGCKPNVKNKETIIEKGALFDENEERLRICK 866

Query: 252  AKVPVTRAKKMPLRNQQFKQMGKFQQLRKKLKVQILVAPMMSHQNRHLSPTKQLKNLTLH 431
            A++  TR +++ +  Q+   + + QQ  +K+K +I V   +   N++   T+ L++  + 
Sbjct: 867  AELETTR-RQVTVLQQKLVSIIQ-QQSSQKIKKRIAV---VEDSNKNTVHTEDLES-KMK 920

Query: 432  QLRNKNHQM 458
            ++  KN ++
Sbjct: 921  EVELKNTEL 929


>U39649-2|AAM69069.1| 1534|Caenorhabditis elegans Hypothetical protein
            T23F2.2a protein.
          Length = 1534

 Score = 28.7 bits (61), Expect = 4.0
 Identities = 28/129 (21%), Positives = 68/129 (52%), Gaps = 4/129 (3%)
 Frame = +3

Query: 84   TEIQADVNSLVHQYLEKIDKSLAQTFMKKTKAKPRAKNQQTLLDIIAKFNQGNK----AK 251
            +++Q+ VN   H   +   +++ +   K    KP  KN++T+++  A F++  +     K
Sbjct: 810  SQLQSRVN---HSQRDVECQAIPRQINKYVGCKPNVKNKETIIEKGALFDENEERLRICK 866

Query: 252  AKVPVTRAKKMPLRNQQFKQMGKFQQLRKKLKVQILVAPMMSHQNRHLSPTKQLKNLTLH 431
            A++  TR +++ +  Q+   + + QQ  +K+K +I V   +   N++   T+ L++  + 
Sbjct: 867  AELETTR-RQVTVLQQKLVSIIQ-QQSSQKIKKRIAV---VEDSNKNTVHTEDLES-KMK 920

Query: 432  QLRNKNHQM 458
            ++  KN ++
Sbjct: 921  EVELKNTEL 929


>Z93396-3|CAB07712.1|  597|Caenorhabditis elegans Hypothetical
           protein ZC15.5 protein.
          Length = 597

 Score = 27.9 bits (59), Expect = 6.9
 Identities = 13/50 (26%), Positives = 26/50 (52%)
 Frame = +3

Query: 51  ILDKNFKMNLTTEIQADVNSLVHQYLEKIDKSLAQTFMKKTKAKPRAKNQ 200
           I + NF+  ++ E  + +   +HQ  EK+ +    TF + T+  P  +N+
Sbjct: 269 IEEDNFESTISIEKCSKLGIFLHQNAEKLARCQVDTFQRITRDLPPFRNK 318


>Z83107-10|CAB05505.1| 1963|Caenorhabditis elegans Hypothetical
            protein F11C3.3 protein.
          Length = 1963

 Score = 27.9 bits (59), Expect = 6.9
 Identities = 21/83 (25%), Positives = 38/83 (45%), Gaps = 2/83 (2%)
 Frame = +3

Query: 36   KEIH*ILDKNFKMNLTTEIQADVNSLVHQYLEKIDKSLAQTFMKKTKAKP--RAKNQQTL 209
            +E+  + +K  +    T  Q +VN      L K+ + L +  M         R K+   +
Sbjct: 1150 RELEELGEKLDEQGGATAAQVEVNKKREAELAKLRRDLEEANMNHENQLGGLRKKHTDAV 1209

Query: 210  LDIIAKFNQGNKAKAKVPVTRAK 278
             ++  + +Q NKAKAKV   +A+
Sbjct: 1210 AELTDQLDQLNKAKAKVEKDKAQ 1232


>Z81499-3|CAB04089.1| 1963|Caenorhabditis elegans Hypothetical protein
            F11C3.3 protein.
          Length = 1963

 Score = 27.9 bits (59), Expect = 6.9
 Identities = 21/83 (25%), Positives = 38/83 (45%), Gaps = 2/83 (2%)
 Frame = +3

Query: 36   KEIH*ILDKNFKMNLTTEIQADVNSLVHQYLEKIDKSLAQTFMKKTKAKP--RAKNQQTL 209
            +E+  + +K  +    T  Q +VN      L K+ + L +  M         R K+   +
Sbjct: 1150 RELEELGEKLDEQGGATAAQVEVNKKREAELAKLRRDLEEANMNHENQLGGLRKKHTDAV 1209

Query: 210  LDIIAKFNQGNKAKAKVPVTRAK 278
             ++  + +Q NKAKAKV   +A+
Sbjct: 1210 AELTDQLDQLNKAKAKVEKDKAQ 1232


>J01050-1|AAA28124.1| 1966|Caenorhabditis elegans myosin heavy chain
            protein.
          Length = 1966

 Score = 27.9 bits (59), Expect = 6.9
 Identities = 21/83 (25%), Positives = 38/83 (45%), Gaps = 2/83 (2%)
 Frame = +3

Query: 36   KEIH*ILDKNFKMNLTTEIQADVNSLVHQYLEKIDKSLAQTFMKKTKAKP--RAKNQQTL 209
            +E+  + +K  +    T  Q +VN      L K+ + L +  M         R K+   +
Sbjct: 1153 RELEELGEKLDEQGGATAAQVEVNKKREAELAKLRRDLEEANMNHENQLGGLRKKHTDAV 1212

Query: 210  LDIIAKFNQGNKAKAKVPVTRAK 278
             ++  + +Q NKAKAKV   +A+
Sbjct: 1213 AELTDQLDQLNKAKAKVEKDKAQ 1235


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,925,078
Number of Sequences: 27780
Number of extensions: 200658
Number of successful extensions: 687
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 659
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 687
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1518563232
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -