SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120038.Seq
         (762 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z82260-3|CAB05131.1|  346|Caenorhabditis elegans Hypothetical pr...    29   4.8  
U39645-9|AAM51511.1|  297|Caenorhabditis elegans Hypothetical pr...    28   8.3  
U39645-8|AAA80361.1|  414|Caenorhabditis elegans Hypothetical pr...    28   8.3  

>Z82260-3|CAB05131.1|  346|Caenorhabditis elegans Hypothetical
           protein C32H11.4 protein.
          Length = 346

 Score = 28.7 bits (61), Expect = 4.8
 Identities = 11/37 (29%), Positives = 20/37 (54%)
 Frame = +3

Query: 45  VGMAPRQMRVNRCIFASIVSFDACITYKSPCSPDAYH 155
           +GM P  + + + +FA+  S D    + SP  P+ Y+
Sbjct: 146 IGMQPHVLNITQDLFAADFSSDKVALFVSPADPNDYY 182


>U39645-9|AAM51511.1|  297|Caenorhabditis elegans Hypothetical
           protein C14F11.1b protein.
          Length = 297

 Score = 27.9 bits (59), Expect = 8.3
 Identities = 9/29 (31%), Positives = 19/29 (65%)
 Frame = +3

Query: 669 EYLQIDTEELRFRNSATCIIDETGLVASV 755
           ++  +D ++ R+ + +TC  DETG +A +
Sbjct: 154 KFAGVDVKQYRYYDKSTCGFDETGALADI 182


>U39645-8|AAA80361.1|  414|Caenorhabditis elegans Hypothetical
           protein C14F11.1a protein.
          Length = 414

 Score = 27.9 bits (59), Expect = 8.3
 Identities = 9/29 (31%), Positives = 19/29 (65%)
 Frame = +3

Query: 669 EYLQIDTEELRFRNSATCIIDETGLVASV 755
           ++  +D ++ R+ + +TC  DETG +A +
Sbjct: 154 KFAGVDVKQYRYYDKSTCGFDETGALADI 182


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,942,484
Number of Sequences: 27780
Number of extensions: 372437
Number of successful extensions: 996
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 962
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 996
length of database: 12,740,198
effective HSP length: 80
effective length of database: 10,517,798
effective search space used: 1819579054
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -