SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120035.Seq
         (749 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X70836-1|CAA50184.1|  636|Caenorhabditis elegans Cytoplasmic int...    29   3.5  
U56860-4|AAM69100.1| 1128|Caenorhabditis elegans Intermediate fi...    29   3.5  
U56860-3|AAM69101.1| 1248|Caenorhabditis elegans Intermediate fi...    29   3.5  
U97189-1|AAC48164.1|  623|Caenorhabditis elegans Hypothetical pr...    29   4.7  
AF036703-2|AAB88557.3|  535|Caenorhabditis elegans Hypothetical ...    29   4.7  
Z75536-1|CAE17805.1|  195|Caenorhabditis elegans Hypothetical pr...    28   6.2  
Z50176-4|CAA90541.1|  546|Caenorhabditis elegans Hypothetical pr...    28   6.2  
U70852-10|AAO91718.1|  505|Caenorhabditis elegans Hypothetical p...    28   6.2  
U70852-9|ABB51183.1|  784|Caenorhabditis elegans Hypothetical pr...    28   6.2  
U70852-8|ABB51182.1|  868|Caenorhabditis elegans Hypothetical pr...    28   6.2  
Z83234-7|CAB76745.1|  667|Caenorhabditis elegans Hypothetical pr...    28   8.1  
Z82067-4|CAB76738.1|  667|Caenorhabditis elegans Hypothetical pr...    28   8.1  

>X70836-1|CAA50184.1|  636|Caenorhabditis elegans Cytoplasmic
           intermediate filament(IF) protein protein.
          Length = 636

 Score = 29.1 bits (62), Expect = 3.5
 Identities = 14/33 (42%), Positives = 20/33 (60%)
 Frame = +3

Query: 6   IGGDTIVNNQTTMTQINFNASYTSAPTPSRASF 104
           +GG T V +QTT T  + N SY++ P  SR  +
Sbjct: 417 VGGSTRVISQTTRTHSSSNTSYSNVPA-SRGGY 448


>U56860-4|AAM69100.1| 1128|Caenorhabditis elegans Intermediate
            filament, c protein2, isoform a protein.
          Length = 1128

 Score = 29.1 bits (62), Expect = 3.5
 Identities = 14/33 (42%), Positives = 20/33 (60%)
 Frame = +3

Query: 6    IGGDTIVNNQTTMTQINFNASYTSAPTPSRASF 104
            +GG T V +QTT T  + N SY++ P  SR  +
Sbjct: 1043 VGGSTRVISQTTRTHSSSNTSYSNVPA-SRGGY 1074


>U56860-3|AAM69101.1| 1248|Caenorhabditis elegans Intermediate
            filament, c protein2, isoform b protein.
          Length = 1248

 Score = 29.1 bits (62), Expect = 3.5
 Identities = 14/33 (42%), Positives = 20/33 (60%)
 Frame = +3

Query: 6    IGGDTIVNNQTTMTQINFNASYTSAPTPSRASF 104
            +GG T V +QTT T  + N SY++ P  SR  +
Sbjct: 1043 VGGSTRVISQTTRTHSSSNTSYSNVPA-SRGGY 1074


>U97189-1|AAC48164.1|  623|Caenorhabditis elegans Hypothetical
           protein C48B6.4 protein.
          Length = 623

 Score = 28.7 bits (61), Expect = 4.7
 Identities = 14/49 (28%), Positives = 23/49 (46%)
 Frame = -1

Query: 539 LNCAFLVFRLHLFLLNWPTTLCESSKYSSSFRLVPAADGWFTPTDCSKD 393
           L C  ++ R  L    +P   C+  K++   +LVP   GW+    C +D
Sbjct: 299 LKCGQIIVR-RLTDPEYPYRHCKIQKFAVRCKLVPENYGWYVVWHCQRD 346


>AF036703-2|AAB88557.3|  535|Caenorhabditis elegans Hypothetical
           protein T11F8.4 protein.
          Length = 535

 Score = 28.7 bits (61), Expect = 4.7
 Identities = 20/72 (27%), Positives = 36/72 (50%), Gaps = 1/72 (1%)
 Frame = -2

Query: 403 AQKIPHYKQNWAMVLRNRQLKGFRIIS-RTNCFSEIISGLEQTFHYIVIISNELTLAKKF 227
           A K+  Y++    VL+  +++  R +S + N    + SGLE  + +IV+    + L K +
Sbjct: 49  AMKMEKYQEGNESVLKG-EVEVLRALSGQKNAIQLLDSGLEPDYRFIVMTLCGMDLQKVY 107

Query: 226 EAAAVSLSDTTV 191
                  SD+TV
Sbjct: 108 NLLKGQFSDSTV 119


>Z75536-1|CAE17805.1|  195|Caenorhabditis elegans Hypothetical
           protein F18C12.4 protein.
          Length = 195

 Score = 28.3 bits (60), Expect = 6.2
 Identities = 11/27 (40%), Positives = 17/27 (62%)
 Frame = +3

Query: 591 VASTQEITHYFTNDFAPYLMRFDDNDY 671
           V+++Q+++  F  DF P L    DNDY
Sbjct: 145 VSTSQKLSETFERDFDPVLEGMSDNDY 171


>Z50176-4|CAA90541.1|  546|Caenorhabditis elegans Hypothetical
           protein C09G1.4 protein.
          Length = 546

 Score = 28.3 bits (60), Expect = 6.2
 Identities = 12/27 (44%), Positives = 16/27 (59%)
 Frame = -1

Query: 425 GWFTPTDCSKDSAL*AELGDGSPQQAA 345
           G+ TP D   DS + A+   GSP+ AA
Sbjct: 28  GYLTPQDSDTDSGISADCDQGSPRAAA 54


>U70852-10|AAO91718.1|  505|Caenorhabditis elegans Hypothetical
           protein F45E4.7b protein.
          Length = 505

 Score = 28.3 bits (60), Expect = 6.2
 Identities = 10/13 (76%), Positives = 10/13 (76%)
 Frame = -3

Query: 717 CNNQSRTYGRRTC 679
           CNN SR Y RRTC
Sbjct: 492 CNNSSRLYNRRTC 504


>U70852-9|ABB51183.1|  784|Caenorhabditis elegans Hypothetical
           protein F45E4.7c protein.
          Length = 784

 Score = 28.3 bits (60), Expect = 6.2
 Identities = 10/13 (76%), Positives = 10/13 (76%)
 Frame = -3

Query: 717 CNNQSRTYGRRTC 679
           CNN SR Y RRTC
Sbjct: 771 CNNSSRLYNRRTC 783


>U70852-8|ABB51182.1|  868|Caenorhabditis elegans Hypothetical
           protein F45E4.7a protein.
          Length = 868

 Score = 28.3 bits (60), Expect = 6.2
 Identities = 10/13 (76%), Positives = 10/13 (76%)
 Frame = -3

Query: 717 CNNQSRTYGRRTC 679
           CNN SR Y RRTC
Sbjct: 855 CNNSSRLYNRRTC 867


>Z83234-7|CAB76745.1|  667|Caenorhabditis elegans Hypothetical
           protein W03H9.4 protein.
          Length = 667

 Score = 27.9 bits (59), Expect = 8.1
 Identities = 10/22 (45%), Positives = 15/22 (68%)
 Frame = +2

Query: 464 WTIHKVWWANLTRINEA*IQEK 529
           W  ++ WW ++TRI E  IQ+K
Sbjct: 257 WAKNETWWMDVTRIAEDEIQKK 278


>Z82067-4|CAB76738.1|  667|Caenorhabditis elegans Hypothetical
           protein W03H9.4 protein.
          Length = 667

 Score = 27.9 bits (59), Expect = 8.1
 Identities = 10/22 (45%), Positives = 15/22 (68%)
 Frame = +2

Query: 464 WTIHKVWWANLTRINEA*IQEK 529
           W  ++ WW ++TRI E  IQ+K
Sbjct: 257 WAKNETWWMDVTRIAEDEIQKK 278


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,483,547
Number of Sequences: 27780
Number of extensions: 353334
Number of successful extensions: 1072
Number of sequences better than 10.0: 12
Number of HSP's better than 10.0 without gapping: 1022
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1072
length of database: 12,740,198
effective HSP length: 80
effective length of database: 10,517,798
effective search space used: 1777507862
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -