SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120034X.Seq
         (582 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z22181-4|CAA80182.1|  824|Caenorhabditis elegans Hypothetical pr...    31   0.79 
U43283-3|AAC69024.2|  880|Caenorhabditis elegans Hypothetical pr...    28   4.2  
U00048-3|AAB53827.3|  315|Caenorhabditis elegans Nematode astaci...    28   5.6  
U40029-12|AAA81131.1|  785|Caenorhabditis elegans Temporarily as...    27   9.7  

>Z22181-4|CAA80182.1|  824|Caenorhabditis elegans Hypothetical
           protein ZK632.5 protein.
          Length = 824

 Score = 30.7 bits (66), Expect = 0.79
 Identities = 19/68 (27%), Positives = 34/68 (50%), Gaps = 4/68 (5%)
 Frame = +3

Query: 135 RFVAKDIASSLKYVNCERAIRVHVDGKYKSTFEHADQIQHML-QIAWQ---SRATRCICT 302
           R   +D  +SLK V+  + + V +DG+YK        +++ + Q+AW    +  TR +  
Sbjct: 93  RLSDEDFENSLKEVSLSQKLMVRIDGEYKYRLYSKPIVRNNIPQLAWDISPALRTRKVAE 152

Query: 303 HTQCSLPN 326
             + S PN
Sbjct: 153 KDEISPPN 160


>U43283-3|AAC69024.2|  880|Caenorhabditis elegans Hypothetical
           protein T25G12.6 protein.
          Length = 880

 Score = 28.3 bits (60), Expect = 4.2
 Identities = 17/38 (44%), Positives = 23/38 (60%), Gaps = 2/38 (5%)
 Frame = +2

Query: 410 QVLCTGKYAP-AVEMDTN-DVIAKIDDLTQKLTVATQI 517
           +V+  G   P A  +DT  DV+ K DDLT   T++TQI
Sbjct: 837 KVIIVGLQLPDATHLDTLCDVLLKWDDLTNTETISTQI 874


>U00048-3|AAB53827.3|  315|Caenorhabditis elegans Nematode astacin
           protease protein 4 protein.
          Length = 315

 Score = 27.9 bits (59), Expect = 5.6
 Identities = 15/43 (34%), Positives = 24/43 (55%), Gaps = 3/43 (6%)
 Frame = -3

Query: 295 IQRVALLCHAIWSMCWIWSACSN---VDLYLPSTWTRIARSQF 176
           IQR +L+  AI++ CW  S  +N   +D  +P T T +  + F
Sbjct: 4   IQRYSLVFCAIFATCWTASVVNNKQVIDTSVPQTETTLNDADF 46


>U40029-12|AAA81131.1|  785|Caenorhabditis elegans Temporarily
           assigned gene nameprotein 151 protein.
          Length = 785

 Score = 27.1 bits (57), Expect = 9.7
 Identities = 13/41 (31%), Positives = 21/41 (51%)
 Frame = +1

Query: 241 TKSSTCSR*RGKAGRPAVFAPTHSAHYQIWRDSTDNEVQIA 363
           TK    S  RG+ G   +    HS H  I +D+  N++++A
Sbjct: 26  TKGEITSENRGREGVKQLTRSAHSTHRTISKDARRNQLKMA 66


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,255,793
Number of Sequences: 27780
Number of extensions: 323999
Number of successful extensions: 881
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 849
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 881
length of database: 12,740,198
effective HSP length: 78
effective length of database: 10,573,358
effective search space used: 1215936170
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -