SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120033.Seq
         (717 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AL033514-5|CAA22082.1|  773|Caenorhabditis elegans Hypothetical ...    30   1.9  
Z70207-8|CAM33501.1|  835|Caenorhabditis elegans Hypothetical pr...    29   2.5  
Z70207-5|CAA94127.2|  914|Caenorhabditis elegans Hypothetical pr...    29   2.5  
U64598-1|AAK39215.2|  330|Caenorhabditis elegans Serpentine rece...    29   2.5  
AF316542-1|AAG50270.1|  914|Caenorhabditis elegans serine/threon...    29   2.5  
Z81513-12|CAE17799.1|  417|Caenorhabditis elegans Hypothetical p...    29   3.3  
AF106575-17|AAD56300.2|  333|Caenorhabditis elegans Serpentine r...    29   4.4  
AL110478-6|CAE17957.2|  952|Caenorhabditis elegans Hypothetical ...    28   7.7  

>AL033514-5|CAA22082.1|  773|Caenorhabditis elegans Hypothetical
           protein Y75B8A.4 protein.
          Length = 773

 Score = 29.9 bits (64), Expect = 1.9
 Identities = 11/32 (34%), Positives = 22/32 (68%)
 Frame = +3

Query: 369 KIIIDTVIKYIGKLADDEYILIADRMYVDLIY 464
           K+ I T+ KY+ + ++D Y++IA ++  D +Y
Sbjct: 32  KLNIQTIEKYLTRSSNDNYVVIAYKVSTDKVY 63


>Z70207-8|CAM33501.1|  835|Caenorhabditis elegans Hypothetical
           protein F15A2.6b protein.
          Length = 835

 Score = 29.5 bits (63), Expect = 2.5
 Identities = 21/68 (30%), Positives = 31/68 (45%), Gaps = 3/68 (4%)
 Frame = +2

Query: 434 SGPHVCRFNLFRI*GHYFASERVHYK---GDYAESDSESGQSVDVCNELKYPWNLITANS 604
           SGP   + N   I   +  + R H +      AESDSE  Q +D  + +K  W    A+S
Sbjct: 587 SGPWRSKLN--NIKNSFLGTPRFHRRKMSNGTAESDSEDSQMIDTTDLVKKSWFGSLASS 644

Query: 605 FIVSTDES 628
             V  D++
Sbjct: 645 MSVERDDT 652


>Z70207-5|CAA94127.2|  914|Caenorhabditis elegans Hypothetical
           protein F15A2.6a protein.
          Length = 914

 Score = 29.5 bits (63), Expect = 2.5
 Identities = 21/68 (30%), Positives = 31/68 (45%), Gaps = 3/68 (4%)
 Frame = +2

Query: 434 SGPHVCRFNLFRI*GHYFASERVHYK---GDYAESDSESGQSVDVCNELKYPWNLITANS 604
           SGP   + N   I   +  + R H +      AESDSE  Q +D  + +K  W    A+S
Sbjct: 587 SGPWRSKLN--NIKNSFLGTPRFHRRKMSNGTAESDSEDSQMIDTTDLVKKSWFGSLASS 644

Query: 605 FIVSTDES 628
             V  D++
Sbjct: 645 MSVERDDT 652


>U64598-1|AAK39215.2|  330|Caenorhabditis elegans Serpentine
           receptor, class v protein6 protein.
          Length = 330

 Score = 29.5 bits (63), Expect = 2.5
 Identities = 15/54 (27%), Positives = 25/54 (46%)
 Frame = -3

Query: 310 IGLINTHSYTSSALRIVFLPRLDRCATSADNTILRARLKTRCLTRSCATCRFRY 149
           +GL+ TH++ +    ++  P   R    A +T L A +   C   +CA C   Y
Sbjct: 145 LGLLPTHAWPNFDFYLLITPTAMRLNNDAVSTALIAYIDGMCCLVTCAFCMICY 198


>AF316542-1|AAG50270.1|  914|Caenorhabditis elegans serine/threonine
           kinase SAD-1 protein.
          Length = 914

 Score = 29.5 bits (63), Expect = 2.5
 Identities = 21/68 (30%), Positives = 31/68 (45%), Gaps = 3/68 (4%)
 Frame = +2

Query: 434 SGPHVCRFNLFRI*GHYFASERVHYK---GDYAESDSESGQSVDVCNELKYPWNLITANS 604
           SGP   + N   I   +  + R H +      AESDSE  Q +D  + +K  W    A+S
Sbjct: 587 SGPWRSKLN--NIKNSFLGTPRFHRRKMSNGTAESDSEDSQMIDTTDLVKKSWFGSLASS 644

Query: 605 FIVSTDES 628
             V  D++
Sbjct: 645 MSVERDDT 652


>Z81513-12|CAE17799.1|  417|Caenorhabditis elegans Hypothetical
           protein F26D2.16 protein.
          Length = 417

 Score = 29.1 bits (62), Expect = 3.3
 Identities = 16/63 (25%), Positives = 28/63 (44%), Gaps = 2/63 (3%)
 Frame = +1

Query: 88  IHPRRANCKVTRPRNNYSDPDNENDMLHM--TVLNSVFLNEHAKLYYRHLLRNDQAEAEK 261
           +H +  NC   R  +++S PD + D+      +L ++ L    K+    L  N     E+
Sbjct: 148 VHAKELNCSQRRALSSFSQPDRKEDVKKFLNQLLKAIQLRHAGKILRAVLHTNRYRSCER 207

Query: 262 QFS 270
            FS
Sbjct: 208 IFS 210


>AF106575-17|AAD56300.2|  333|Caenorhabditis elegans Serpentine
           receptor, class h protein5 protein.
          Length = 333

 Score = 28.7 bits (61), Expect = 4.4
 Identities = 20/71 (28%), Positives = 37/71 (52%)
 Frame = -3

Query: 439 SAIKMYSSSASLPMYLMTVSMMIFKTPMLCSPASSTLLKCSVRIGLINTHSYTSSALRIV 260
           S + + S+S S+P+Y++   ++IFK+P+  S   + L+       L+  H  T   + I+
Sbjct: 15  STLHIISTSISVPIYIVAFWILIFKSPVHFSKYRNYLVAHVFSGLLLELHMGTIWKVTII 74

Query: 259 FLPRLDRCATS 227
            LP    C+ S
Sbjct: 75  -LPIPIMCSNS 84


>AL110478-6|CAE17957.2|  952|Caenorhabditis elegans Hypothetical
            protein Y26D4A.14 protein.
          Length = 952

 Score = 27.9 bits (59), Expect = 7.7
 Identities = 19/57 (33%), Positives = 27/57 (47%), Gaps = 8/57 (14%)
 Frame = +2

Query: 563  NELKYPWNLI--TANSFIVSTDESRQSQYIYRTF------LLYNTVLTAILKQNNPF 709
            N +K P N I   AN FIV T +     YIYR        + +N ++T++ K    F
Sbjct: 872  NYIKLPKNTIRENANFFIVFTQDKLNLDYIYRDHCGEIDKIKFNEMITSVWKDKYSF 928


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,948,260
Number of Sequences: 27780
Number of extensions: 297871
Number of successful extensions: 984
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 961
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 984
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1676746902
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -