SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120031.Seq
         (726 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AL023838-2|CAA19505.1|  452|Caenorhabditis elegans Hypothetical ...    30   1.9  
Z93377-3|CAB07580.1|  358|Caenorhabditis elegans Hypothetical pr...    29   4.5  
U23452-5|AAK31546.1|  304|Caenorhabditis elegans Hypothetical pr...    29   4.5  
AC025724-8|AAG23381.1|  460|Caenorhabditis elegans Hypothetical ...    29   4.5  
U70851-5|AAB09127.1|  305|Caenorhabditis elegans Hypothetical pr...    28   5.9  
AL110478-3|CAB54348.1|  380|Caenorhabditis elegans Hypothetical ...    28   5.9  

>AL023838-2|CAA19505.1|  452|Caenorhabditis elegans Hypothetical
           protein Y43C5A.2 protein.
          Length = 452

 Score = 29.9 bits (64), Expect = 1.9
 Identities = 14/33 (42%), Positives = 16/33 (48%)
 Frame = -3

Query: 112 YVSADTDADEPIIYFENITECLTDDQCDKFTYF 14
           Y S  TD       F+N T  L  D CD+F YF
Sbjct: 327 YSSTYTDLGAKFSTFDNFTGPLGKDDCDEFQYF 359


>Z93377-3|CAB07580.1|  358|Caenorhabditis elegans Hypothetical
           protein F13A7.7 protein.
          Length = 358

 Score = 28.7 bits (61), Expect = 4.5
 Identities = 26/110 (23%), Positives = 56/110 (50%), Gaps = 5/110 (4%)
 Frame = +1

Query: 400 LATVSHRIYGQNHRTQFAFVPAQEFYLHVYHHMGHHDFLSLIIDDMVYTRDKSSLDFVMQ 579
           +A V  ++ G+N   Q  F   +E Y+ V+++  HH F+   I D + T D +    +++
Sbjct: 87  MADVRKQLTGRNPAVQVLFDKTREHYILVHYNPRHH-FIE--IYDSLQTFDTNGKPTIIR 143

Query: 580 QL-KTMKVLFYNVF-FILQCAMCRDHYMNVKGFLI-YHI--ELIEIALDK 714
           ++   +  +F ++F   + C + +++ +    F   Y +   L++IA DK
Sbjct: 144 EICVQISNMFGHLFRRDIPCLIDKEYELQSDNFSCGYRVIGALVDIARDK 193


>U23452-5|AAK31546.1|  304|Caenorhabditis elegans Hypothetical
           protein R07G3.6 protein.
          Length = 304

 Score = 28.7 bits (61), Expect = 4.5
 Identities = 13/22 (59%), Positives = 15/22 (68%)
 Frame = -1

Query: 138 VRRRPQRRCTLAPTRTPTSLLF 73
           +RR+PQ   TL PT TPT  LF
Sbjct: 159 LRRKPQSIPTLPPTTTPTPRLF 180


>AC025724-8|AAG23381.1|  460|Caenorhabditis elegans Hypothetical
           protein Y67D8C.2 protein.
          Length = 460

 Score = 28.7 bits (61), Expect = 4.5
 Identities = 12/46 (26%), Positives = 26/46 (56%), Gaps = 4/46 (8%)
 Frame = +1

Query: 574 MQQLKTMKVLFYNVFFILQCAMCR----DHYMNVKGFLIYHIELIE 699
           M++LK   ++    +++ +  +CR    DHY  +K F+I ++  +E
Sbjct: 1   MKRLKLRTLISNEYYYVAEAEVCRAPLADHYKVLKNFIISYVRKLE 46


>U70851-5|AAB09127.1|  305|Caenorhabditis elegans Hypothetical
           protein M02B7.1 protein.
          Length = 305

 Score = 28.3 bits (60), Expect = 5.9
 Identities = 15/41 (36%), Positives = 21/41 (51%)
 Frame = +3

Query: 534 YGVYARQKQSRFCHAAVENDEGAILQRIFHTTVRHVPRSLY 656
           Y +   Q  S    + +E DE  IL+   H  +RHVPR L+
Sbjct: 137 YSIIIPQSLSMEMLSRIEQDE--ILKTAKHLDIRHVPRELF 175


>AL110478-3|CAB54348.1|  380|Caenorhabditis elegans Hypothetical
           protein Y26D4A.8 protein.
          Length = 380

 Score = 28.3 bits (60), Expect = 5.9
 Identities = 16/44 (36%), Positives = 24/44 (54%), Gaps = 4/44 (9%)
 Frame = +1

Query: 316 VFDEIQRHSKIRGAAVDRMGH*RIPRHGLA----TVSHRIYGQN 435
           +F E+Q+HS+I  A V+++   R   H LA    T  H  YG +
Sbjct: 285 LFKELQKHSRILYATVNKIPVVRKTNHALACVRKTTEHLAYGSS 328


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,905,473
Number of Sequences: 27780
Number of extensions: 363260
Number of successful extensions: 986
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 946
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 982
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1708383636
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -