SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120028.Seq
         (721 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U50301-10|AAV28351.1|  513|Caenorhabditis elegans Hypothetical p...    32   0.47 
Z83239-8|CAH60787.1|  311|Caenorhabditis elegans Hypothetical pr...    31   0.83 
Z68297-2|CAA92594.3|  522|Caenorhabditis elegans Hypothetical pr...    30   1.4  
Z78543-6|CAB01756.1| 2962|Caenorhabditis elegans Hypothetical pr...    29   2.5  
Z78417-13|CAB01693.1| 2962|Caenorhabditis elegans Hypothetical p...    29   2.5  
AF111934-1|AAD18003.1| 2962|Caenorhabditis elegans SDC-2 protein.      29   2.5  
AC024826-10|AAM97977.1|  435|Caenorhabditis elegans Hypothetical...    29   2.5  
AC024826-8|AAF60795.2|  580|Caenorhabditis elegans Hypothetical ...    29   2.5  
Z83244-7|CAB05829.1|  318|Caenorhabditis elegans Hypothetical pr...    29   3.3  
Z81552-4|CAB04488.2|  765|Caenorhabditis elegans Hypothetical pr...    29   3.3  
AL110479-16|CAB54362.1|  200|Caenorhabditis elegans Hypothetical...    29   4.4  
Z79695-4|CAB01969.3|  374|Caenorhabditis elegans Hypothetical pr...    28   7.7  
AC024807-1|AAF59529.5|  704|Caenorhabditis elegans Hypothetical ...    28   7.7  

>U50301-10|AAV28351.1|  513|Caenorhabditis elegans Hypothetical
           protein F20D6.12 protein.
          Length = 513

 Score = 31.9 bits (69), Expect = 0.47
 Identities = 17/71 (23%), Positives = 34/71 (47%)
 Frame = -2

Query: 357 NNFV*MVNLIAVPIAIKYVVVRNFKTFAKIYYIVDFAFVSLCTYLYLKLCVLHLNESHLT 178
           N+F+ +  ++ +     +VV    + F    ++ DFAFV      Y  +    L+   L+
Sbjct: 48  NSFLFIFTILGISDIFYFVVTLLCELFHYTNWVPDFAFVCCVVASYYGVFFNLLSNGLLS 107

Query: 177 MCDYCWTFMWY 145
           +  +C T++WY
Sbjct: 108 LNRFCATWVWY 118


>Z83239-8|CAH60787.1|  311|Caenorhabditis elegans Hypothetical
           protein T09F5.16 protein.
          Length = 311

 Score = 31.1 bits (67), Expect = 0.83
 Identities = 14/64 (21%), Positives = 30/64 (46%)
 Frame = -2

Query: 369 LLVKNNFV*MVNLIAVPIAIKYVVVRNFKTFAKIYYIVDFAFVSLCTYLYLKLCVLHLNE 190
           ++V+N ++  +    + I + Y+   N  T+  +  +    FV LC  LY+ + +     
Sbjct: 138 VVVRNLYICFIIKSVMLIILPYIYTANILTYTTLILLFQNLFVFLCALLYIPILISIRKA 197

Query: 189 SHLT 178
            HL+
Sbjct: 198 RHLS 201


>Z68297-2|CAA92594.3|  522|Caenorhabditis elegans Hypothetical
           protein F11A10.3 protein.
          Length = 522

 Score = 30.3 bits (65), Expect = 1.4
 Identities = 14/38 (36%), Positives = 19/38 (50%)
 Frame = -2

Query: 264 YIVDFAFVSLCTYLYLKLCVLHLNESHLTMCDYCWTFM 151
           YIVD   +  C + + K C+L   ES    C  C TF+
Sbjct: 308 YIVDATTIIDCMHTFCKSCLLTYFESDNNTCPTCGTFI 345


>Z78543-6|CAB01756.1| 2962|Caenorhabditis elegans Hypothetical protein
            C35C5.1 protein.
          Length = 2962

 Score = 29.5 bits (63), Expect = 2.5
 Identities = 12/34 (35%), Positives = 20/34 (58%)
 Frame = +3

Query: 516  KIESVLKHVKKLNTNSEKFMVTHETFKNDVGNRF 617
            K+E   + + KL  N +K  ++H++ KND   RF
Sbjct: 1738 KLERDFEEIVKLIQNEKKLALSHKSHKNDENRRF 1771


>Z78417-13|CAB01693.1| 2962|Caenorhabditis elegans Hypothetical
            protein C35C5.1 protein.
          Length = 2962

 Score = 29.5 bits (63), Expect = 2.5
 Identities = 12/34 (35%), Positives = 20/34 (58%)
 Frame = +3

Query: 516  KIESVLKHVKKLNTNSEKFMVTHETFKNDVGNRF 617
            K+E   + + KL  N +K  ++H++ KND   RF
Sbjct: 1738 KLERDFEEIVKLIQNEKKLALSHKSHKNDENRRF 1771


>AF111934-1|AAD18003.1| 2962|Caenorhabditis elegans SDC-2 protein.
          Length = 2962

 Score = 29.5 bits (63), Expect = 2.5
 Identities = 12/34 (35%), Positives = 20/34 (58%)
 Frame = +3

Query: 516  KIESVLKHVKKLNTNSEKFMVTHETFKNDVGNRF 617
            K+E   + + KL  N +K  ++H++ KND   RF
Sbjct: 1738 KLERDFEEIVKLIQNEKKLALSHKSHKNDENRRF 1771


>AC024826-10|AAM97977.1|  435|Caenorhabditis elegans Hypothetical
           protein Y55F3AM.3c protein.
          Length = 435

 Score = 29.5 bits (63), Expect = 2.5
 Identities = 12/40 (30%), Positives = 17/40 (42%)
 Frame = -1

Query: 517 LSRNHHARLQFEGAATRCFCCQNLTASKFSTTPAWSRTMR 398
           ++  H    Q    AT+CF   N+      T PAW   +R
Sbjct: 261 MAAQHAGHSQIPSIATQCFLLSNMFDPSKETEPAWDHDIR 300


>AC024826-8|AAF60795.2|  580|Caenorhabditis elegans Hypothetical
           protein Y55F3AM.3a protein.
          Length = 580

 Score = 29.5 bits (63), Expect = 2.5
 Identities = 12/40 (30%), Positives = 17/40 (42%)
 Frame = -1

Query: 517 LSRNHHARLQFEGAATRCFCCQNLTASKFSTTPAWSRTMR 398
           ++  H    Q    AT+CF   N+      T PAW   +R
Sbjct: 406 MAAQHAGHSQIPSIATQCFLLSNMFDPSKETEPAWDHDIR 445


>Z83244-7|CAB05829.1|  318|Caenorhabditis elegans Hypothetical
           protein W06F12.3 protein.
          Length = 318

 Score = 29.1 bits (62), Expect = 3.3
 Identities = 16/60 (26%), Positives = 30/60 (50%)
 Frame = +1

Query: 322 DSDQVYHLNEIIFHKQKSKRDLNSLGALFATKQGLLKILMRLNFDNKSNALLHLQTEGER 501
           D DQVYH  +++    +S++    +G  F T    L+++ R    N  N ++ L++   R
Sbjct: 246 DQDQVYHAKQLLLRNFQSRK----MGQNFGTFPRALELIKRTETPNYENFIVILKSCSSR 301


>Z81552-4|CAB04488.2|  765|Caenorhabditis elegans Hypothetical
           protein F56G4.6 protein.
          Length = 765

 Score = 29.1 bits (62), Expect = 3.3
 Identities = 12/31 (38%), Positives = 17/31 (54%)
 Frame = -1

Query: 667 SMLSLASSSFKRNSNCSNLLPTSFLNVSWVT 575
           ++L L   S K   NCS +LP SF  +  +T
Sbjct: 109 TLLKLCKKSIKTTGNCSKILPISFRELPGLT 139


>AL110479-16|CAB54362.1|  200|Caenorhabditis elegans Hypothetical
           protein Y105C5B.17 protein.
          Length = 200

 Score = 28.7 bits (61), Expect = 4.4
 Identities = 11/36 (30%), Positives = 20/36 (55%)
 Frame = +1

Query: 244 ERKIYNVIDFCKGLEIAHDDILDCNWDSDQVYHLNE 351
           ERKI N+ +     E+A  +  +C+WD D   ++ +
Sbjct: 60  ERKISNMHELVFDEELAKKEFQECSWDKDHFINVKD 95


>Z79695-4|CAB01969.3|  374|Caenorhabditis elegans Hypothetical
           protein F27D4.4a protein.
          Length = 374

 Score = 27.9 bits (59), Expect = 7.7
 Identities = 13/31 (41%), Positives = 20/31 (64%)
 Frame = +1

Query: 286 EIAHDDILDCNWDSDQVYHLNEIIFHKQKSK 378
           E+  D+  + NWDSD+   LNE++  K K+K
Sbjct: 133 EVEKDEETNENWDSDK---LNEVVNKKNKNK 160


>AC024807-1|AAF59529.5|  704|Caenorhabditis elegans Hypothetical
           protein Y53G8AL.1 protein.
          Length = 704

 Score = 27.9 bits (59), Expect = 7.7
 Identities = 16/56 (28%), Positives = 28/56 (50%)
 Frame = +3

Query: 513 DKIESVLKHVKKLNTNSEKFMVTHETFKNDVGNRFEQFELRLNELDAKLNMLQSAE 680
           D +  + K V+ L TN ++  +T  +FK D  N    FE+  ++L + +     AE
Sbjct: 96  DTVTRISKLVESLKTNLDQ--LTEHSFKEDRPNSVLFFEITHDDLKSSIKKYSDAE 149


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,301,715
Number of Sequences: 27780
Number of extensions: 282057
Number of successful extensions: 899
Number of sequences better than 10.0: 13
Number of HSP's better than 10.0 without gapping: 863
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 899
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1687292480
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -