SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120027.Seq
         (774 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U70856-4|AAB09167.1| 2090|Caenorhabditis elegans Hypothetical pr...    29   3.7  
U70856-3|AAB09166.1| 2153|Caenorhabditis elegans Gei-4(four) int...    29   3.7  
U23168-1|AAU87832.1| 7548|Caenorhabditis elegans Temporarily ass...    29   3.7  
Z50176-4|CAA90541.1|  546|Caenorhabditis elegans Hypothetical pr...    28   6.4  
AF188477-1|AAF01458.1| 1418|Caenorhabditis elegans phospholipase...    28   6.4  
AF179426-1|AAF05701.1| 1431|Caenorhabditis elegans phospholipase...    28   6.4  
AF068714-7|AAT68905.1|  592|Caenorhabditis elegans Egg laying de...    28   6.4  
AF068714-6|AAL77167.1| 1419|Caenorhabditis elegans Egg laying de...    28   6.4  
AF068714-5|AAL77168.1| 1431|Caenorhabditis elegans Egg laying de...    28   6.4  
AF016426-2|AAB65345.1|  335|Caenorhabditis elegans Hypothetical ...    28   6.4  

>U70856-4|AAB09167.1| 2090|Caenorhabditis elegans Hypothetical protein
            F57F4.4 protein.
          Length = 2090

 Score = 29.1 bits (62), Expect = 3.7
 Identities = 13/34 (38%), Positives = 16/34 (47%)
 Frame = +2

Query: 20   FCESNHEFDLDSASCKPIVYDRTGSGCAARMYRN 121
            FC     +D     CKP+ YD T +GC    Y N
Sbjct: 1536 FCRQLEMYD----ECKPLPYDTTVTGCCCDNYNN 1565


>U70856-3|AAB09166.1| 2153|Caenorhabditis elegans Gei-4(four)
            interacting proteinprotein 1 protein.
          Length = 2153

 Score = 29.1 bits (62), Expect = 3.7
 Identities = 13/34 (38%), Positives = 16/34 (47%)
 Frame = +2

Query: 20   FCESNHEFDLDSASCKPIVYDRTGSGCAARMYRN 121
            FC     +D     CKP+ YD T +GC    Y N
Sbjct: 1536 FCRQLEMYD----ECKPLPYDTTVTGCCCDNYNN 1565


>U23168-1|AAU87832.1| 7548|Caenorhabditis elegans Temporarily assigned
            gene nameprotein 308, isoform c protein.
          Length = 7548

 Score = 29.1 bits (62), Expect = 3.7
 Identities = 15/50 (30%), Positives = 23/50 (46%)
 Frame = +3

Query: 375  QPNDYLNYYNNPTPDGADTVVSDSETAAASNFLASVNSLTDDNDIWNVCS 524
            Q +   +YY  P P  A+T  ++S   A S  L     +T  + IW+  S
Sbjct: 4063 QVDSKYDYYRRPAPKNAETTFTESNADAFSLALQEAGEVT-SSGIWSTVS 4111


>Z50176-4|CAA90541.1|  546|Caenorhabditis elegans Hypothetical
           protein C09G1.4 protein.
          Length = 546

 Score = 28.3 bits (60), Expect = 6.4
 Identities = 12/27 (44%), Positives = 16/27 (59%)
 Frame = -2

Query: 662 GWFTPTDCSKDSAL*AELGDGSPQQAA 582
           G+ TP D   DS + A+   GSP+ AA
Sbjct: 28  GYLTPQDSDTDSGISADCDQGSPRAAA 54


>AF188477-1|AAF01458.1| 1418|Caenorhabditis elegans phospholipase C
           beta protein.
          Length = 1418

 Score = 28.3 bits (60), Expect = 6.4
 Identities = 15/42 (35%), Positives = 22/42 (52%), Gaps = 3/42 (7%)
 Frame = -3

Query: 283 VIVVWLFTIVRRQCQLAKKCRAHHKDI---DIFKHLCPELQI 167
           ++ V  F +V    +LAK CRA   DI      +H+CP  Q+
Sbjct: 105 LVNVQSFFLVAESVELAKTCRAGINDILKSSRIRHVCPTTQL 146


>AF179426-1|AAF05701.1| 1431|Caenorhabditis elegans phospholipase C
           beta homolog EGL-8 protein.
          Length = 1431

 Score = 28.3 bits (60), Expect = 6.4
 Identities = 15/42 (35%), Positives = 22/42 (52%), Gaps = 3/42 (7%)
 Frame = -3

Query: 283 VIVVWLFTIVRRQCQLAKKCRAHHKDI---DIFKHLCPELQI 167
           ++ V  F +V    +LAK CRA   DI      +H+CP  Q+
Sbjct: 105 LVNVQSFFLVAESVELAKTCRAGINDILKSSRIRHVCPTTQL 146


>AF068714-7|AAT68905.1|  592|Caenorhabditis elegans Egg laying
           defective protein 8,isoform c protein.
          Length = 592

 Score = 28.3 bits (60), Expect = 6.4
 Identities = 15/42 (35%), Positives = 22/42 (52%), Gaps = 3/42 (7%)
 Frame = -3

Query: 283 VIVVWLFTIVRRQCQLAKKCRAHHKDI---DIFKHLCPELQI 167
           ++ V  F +V    +LAK CRA   DI      +H+CP  Q+
Sbjct: 105 LVNVQSFFLVAESVELAKTCRAGINDILKSSRIRHVCPTTQL 146


>AF068714-6|AAL77167.1| 1419|Caenorhabditis elegans Egg laying
           defective protein 8,isoform a protein.
          Length = 1419

 Score = 28.3 bits (60), Expect = 6.4
 Identities = 15/42 (35%), Positives = 22/42 (52%), Gaps = 3/42 (7%)
 Frame = -3

Query: 283 VIVVWLFTIVRRQCQLAKKCRAHHKDI---DIFKHLCPELQI 167
           ++ V  F +V    +LAK CRA   DI      +H+CP  Q+
Sbjct: 105 LVNVQSFFLVAESVELAKTCRAGINDILKSSRIRHVCPTTQL 146


>AF068714-5|AAL77168.1| 1431|Caenorhabditis elegans Egg laying
           defective protein 8,isoform b protein.
          Length = 1431

 Score = 28.3 bits (60), Expect = 6.4
 Identities = 15/42 (35%), Positives = 22/42 (52%), Gaps = 3/42 (7%)
 Frame = -3

Query: 283 VIVVWLFTIVRRQCQLAKKCRAHHKDI---DIFKHLCPELQI 167
           ++ V  F +V    +LAK CRA   DI      +H+CP  Q+
Sbjct: 105 LVNVQSFFLVAESVELAKTCRAGINDILKSSRIRHVCPTTQL 146


>AF016426-2|AAB65345.1|  335|Caenorhabditis elegans Hypothetical
           protein W07B8.4 protein.
          Length = 335

 Score = 28.3 bits (60), Expect = 6.4
 Identities = 12/31 (38%), Positives = 17/31 (54%), Gaps = 1/31 (3%)
 Frame = -2

Query: 122 SFYTCEPHTRCPCDRTR*ACSWPS-PSRIRD 33
           S Y C+P++  PC  T    +WP  P +I D
Sbjct: 170 SQYGCKPYSIAPCGETIDGVTWPECPMKISD 200


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,659,412
Number of Sequences: 27780
Number of extensions: 375185
Number of successful extensions: 1115
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 1058
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1115
length of database: 12,740,198
effective HSP length: 80
effective length of database: 10,517,798
effective search space used: 1861650246
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -