SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120026.Seq
         (729 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z71178-6|CAA94880.2| 1185|Caenorhabditis elegans Hypothetical pr...    29   2.6  
Z81117-7|CAB03315.2|  329|Caenorhabditis elegans Hypothetical pr...    29   3.4  
Z50110-3|CAA90445.2|  459|Caenorhabditis elegans Hypothetical pr...    29   3.4  
AY559748-1|AAS72410.1|  671|Caenorhabditis elegans heat shock tr...    29   4.5  
AY559747-1|AAS72409.1|  671|Caenorhabditis elegans heat shock tr...    29   4.5  
AL033536-5|CAA22146.1|  671|Caenorhabditis elegans Hypothetical ...    29   4.5  
AC006733-4|AAF60486.1|  319|Caenorhabditis elegans Dehydrogenase...    29   4.5  
AL132877-17|CAB60849.2|  269|Caenorhabditis elegans Hypothetical...    28   5.9  
AC024791-10|ABM74563.1| 1736|Caenorhabditis elegans Hypothetical...    28   5.9  
Z81508-8|CAI58634.1|  294|Caenorhabditis elegans Hypothetical pr...    28   7.9  

>Z71178-6|CAA94880.2| 1185|Caenorhabditis elegans Hypothetical protein
            B0024.8 protein.
          Length = 1185

 Score = 29.5 bits (63), Expect = 2.6
 Identities = 24/102 (23%), Positives = 46/102 (45%), Gaps = 2/102 (1%)
 Frame = +3

Query: 300  LNVMPVMQDERKMSKRKKKVINNNKYILFN--SWYTKIKQPEWPSSPAMWDLVKNTPELA 473
            ++++P M    K S  K++     +Y   +  ++ +K KQ E  + P +WD VKN+    
Sbjct: 1083 VSLLPAMTSATKKSNVKQRPFILTQYCELSKLAYKSKPKQVEVMALPLLWDSVKNSAPDV 1142

Query: 474  DFVFIFDHTEKMVKKWPTDRHRRLQATTQQFQRAKKDRLRCL 599
            D      +  K + K   ++ + L   T +    +K +L  L
Sbjct: 1143 DNKKATQYLAKTLAKLIGEK-QLLDLATSELDPNRKKQLDAL 1183


>Z81117-7|CAB03315.2|  329|Caenorhabditis elegans Hypothetical
           protein T06E6.6 protein.
          Length = 329

 Score = 29.1 bits (62), Expect = 3.4
 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 2/44 (4%)
 Frame = -2

Query: 431 ATRPLGLLD--LSVPTVKQNVFIVVNHLLLAFGHFAFVLHDRHY 306
           A  PLG+L     VPT  Q  F+  N  ++   HF  V+ +R+Y
Sbjct: 72  AGTPLGILTEWFEVPTSFQTYFVFTNFFIVMVNHF-LVVENRYY 114


>Z50110-3|CAA90445.2|  459|Caenorhabditis elegans Hypothetical
           protein F18H3.4 protein.
          Length = 459

 Score = 29.1 bits (62), Expect = 3.4
 Identities = 16/43 (37%), Positives = 23/43 (53%)
 Frame = +1

Query: 130 KSNMVNMPEQQSSTETAAVCKNEKLLNKLESSSYNKSNMDQLL 258
           K N+    EQ   TE  A+ +N+KLL  L   + ++  MDQ L
Sbjct: 121 KRNLSARDEQALVTEIDALKRNKKLLESLAEITSHRKGMDQEL 163


>AY559748-1|AAS72410.1|  671|Caenorhabditis elegans heat shock
           transcription factor 1 protein.
          Length = 671

 Score = 28.7 bits (61), Expect = 4.5
 Identities = 12/42 (28%), Positives = 20/42 (47%)
 Frame = +2

Query: 602 NANLAELKESCEMRDKLYSEFYSLLNETFNNNVAPLLSSIYD 727
           N+     K+ C++ + L  E     +  F NN  PL+S + D
Sbjct: 308 NSEEGPYKDVCDLLESLQRETQEPFSRRFTNNEGPLISEVTD 349


>AY559747-1|AAS72409.1|  671|Caenorhabditis elegans heat shock
           transcription factor 1 protein.
          Length = 671

 Score = 28.7 bits (61), Expect = 4.5
 Identities = 12/42 (28%), Positives = 20/42 (47%)
 Frame = +2

Query: 602 NANLAELKESCEMRDKLYSEFYSLLNETFNNNVAPLLSSIYD 727
           N+     K+ C++ + L  E     +  F NN  PL+S + D
Sbjct: 308 NSEEGPYKDVCDLLESLQRETQEPFSRRFTNNEGPLISEVTD 349


>AL033536-5|CAA22146.1|  671|Caenorhabditis elegans Hypothetical
           protein Y53C10A.12 protein.
          Length = 671

 Score = 28.7 bits (61), Expect = 4.5
 Identities = 12/42 (28%), Positives = 20/42 (47%)
 Frame = +2

Query: 602 NANLAELKESCEMRDKLYSEFYSLLNETFNNNVAPLLSSIYD 727
           N+     K+ C++ + L  E     +  F NN  PL+S + D
Sbjct: 308 NSEEGPYKDVCDLLESLQRETQEPFSRRFTNNEGPLISEVTD 349


>AC006733-4|AAF60486.1|  319|Caenorhabditis elegans Dehydrogenases,
           short chain protein9 protein.
          Length = 319

 Score = 28.7 bits (61), Expect = 4.5
 Identities = 27/127 (21%), Positives = 56/127 (44%), Gaps = 4/127 (3%)
 Frame = +3

Query: 90  IIKNTSGSFQRFTKIKHGKHAGATIFYRNCGRVQK*KVVE*TGIELLQ----QIQHGPAI 257
           I+   S    R   ++ G+ AGAT++    GR  +  +    G+  L+    +I      
Sbjct: 9   IVTGASRGIGRGIALQLGE-AGATVYIT--GRKPEESLNSKVGLSGLEATADEITKRGGK 65

Query: 258 AIVNFLEKKNINYILNVMPVMQDERKMSKRKKKVINNNKYILFNSWYTKIKQPEWPSSPA 437
            I  F++ +N+  + N   V++ E +    +  ++ NN Y    +    + +P + + P 
Sbjct: 66  GIARFVDHQNMEEVKNFFEVVEKEHQ---GQLDILVNNAYQGVTAISENMGKPFYETDPY 122

Query: 438 MWDLVKN 458
           +WD + N
Sbjct: 123 VWDTINN 129


>AL132877-17|CAB60849.2|  269|Caenorhabditis elegans Hypothetical
           protein Y105E8B.7 protein.
          Length = 269

 Score = 28.3 bits (60), Expect = 5.9
 Identities = 19/53 (35%), Positives = 25/53 (47%)
 Frame = -2

Query: 680 RLTSCKTPNKAYRAFRSSLLILPNLRW*APQSVFFCSLELLRCRLKTTMSIGR 522
           RL  C   +  Y+A    LL LP+ +    Q+    S +L RC   T M IGR
Sbjct: 211 RLNECTDSHVIYKA-SEYLLTLPDTK--LSQTTLKLSFDLSRCDSTTLMDIGR 260


>AC024791-10|ABM74563.1| 1736|Caenorhabditis elegans Hypothetical
            protein Y47G6A.17 protein.
          Length = 1736

 Score = 28.3 bits (60), Expect = 5.9
 Identities = 14/53 (26%), Positives = 25/53 (47%)
 Frame = +1

Query: 532  DIVVFKRQRSNSSEQKKTDCGAYQRKFGRIKRELRNAR*ALFGVLQLVKRDIQ 690
            ++  F+R   NS E++ TD      +     R LRNA   +   L  +K+ ++
Sbjct: 1345 ELSTFRRNNENSDERRMTDLRVELDRLRTTNRTLRNANEEMKNELSRLKQTVE 1397


>Z81508-8|CAI58634.1|  294|Caenorhabditis elegans Hypothetical
           protein F20E11.15 protein.
          Length = 294

 Score = 27.9 bits (59), Expect = 7.9
 Identities = 21/70 (30%), Positives = 36/70 (51%), Gaps = 6/70 (8%)
 Frame = -2

Query: 506 LFSVIKNEHKICQFGRVFHQIPHGRATRPLGLLDLSVP---TVKQNVFIVV---NHLLLA 345
           LF++I +   IC+ G+  ++ P       L L+D+ +     V  ++F+ V   N+LL  
Sbjct: 188 LFAIILSLKLICKAGKTTNKDPTMNRANRLALIDVIIIFFFDVLLSIFLTVFDQNNLLTN 247

Query: 344 FGHFAFVLHD 315
            G FA VL +
Sbjct: 248 SGPFASVLRE 257


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,395,395
Number of Sequences: 27780
Number of extensions: 391416
Number of successful extensions: 1156
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 1107
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1156
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1718929214
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -