SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120024.Seq
         (770 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AL132847-5|CAB60384.2|  280|Caenorhabditis elegans Hypothetical ...   105   3e-23
AL110500-23|CAB63414.1|  280|Caenorhabditis elegans Hypothetical...   105   3e-23
AL132948-2|CAC51076.2|  496|Caenorhabditis elegans Hypothetical ...    31   1.2  
U21321-10|AAG00048.2|  325|Caenorhabditis elegans T box family p...    29   4.8  
Z81592-5|CAB04727.1|  434|Caenorhabditis elegans Hypothetical pr...    28   6.4  
AF040648-3|AAL06034.2|  453|Caenorhabditis elegans Hypothetical ...    28   6.4  
AF040648-1|AAK21412.1|  519|Caenorhabditis elegans Hypothetical ...    28   6.4  
AB007816-1|BAA28352.1|  394|Caenorhabditis elegans matrix metall...    28   6.4  

>AL132847-5|CAB60384.2|  280|Caenorhabditis elegans Hypothetical
           protein Y48G10A.1 protein.
          Length = 280

 Score =  105 bits (252), Expect = 3e-23
 Identities = 44/79 (55%), Positives = 59/79 (74%)
 Frame = +1

Query: 256 TCSEQNFITKSGFQRYAAEHGVIVVGPDTSPRGVKIDGDDSSWDFGVSAGFYLDATNEPW 435
           TC+  NF+ KSGFQ++A++H ++VV PDTSPRGV +DGD  SWDFG  AGFY++AT E W
Sbjct: 55  TCTHANFMEKSGFQQFASKHRLVVVHPDTSPRGVDVDGDSESWDFGKGAGFYVNATVEKW 114

Query: 436 NNNYRMGSYLNVELYDLIL 492
             NYRM  Y+  EL + ++
Sbjct: 115 AKNYRMYDYIVKELLEEVV 133



 Score = 84.2 bits (199), Expect = 9e-17
 Identities = 37/69 (53%), Positives = 51/69 (73%), Gaps = 1/69 (1%)
 Frame = +3

Query: 561 ALVSTLRNPGQYKSVSAFAAICNPSACPWGVKAFSGYLG-EDKSKWAEWDATELVKKYNG 737
           AL   LRN  +++S+SAFA ICNP   PWG KA +GYLG EDKS W ++DA+E++K Y+G
Sbjct: 156 ALTIGLRNSSKFQSISAFAPICNPITVPWGQKALTGYLGDEDKSTWNQYDASEVLKAYSG 215

Query: 738 PPLTLLLDR 764
           P   +L+D+
Sbjct: 216 PKREILVDQ 224



 Score = 55.2 bits (127), Expect = 5e-08
 Identities = 27/51 (52%), Positives = 33/51 (64%)
 Frame = +2

Query: 101 LESSNKIFGGYQKVYSHASSELKCKMNFSIYLPPQAEGGDVKLPLLYYLSG 253
           L SSN+ F G Q VY HASS  +C+M F +Y+P      D KLP L+YLSG
Sbjct: 5   LVSSNRSFKGRQFVYKHASSTTQCEMTFGVYIPDHKP--DEKLPALFYLSG 53


>AL110500-23|CAB63414.1|  280|Caenorhabditis elegans Hypothetical
           protein Y48G10A.1 protein.
          Length = 280

 Score =  105 bits (252), Expect = 3e-23
 Identities = 44/79 (55%), Positives = 59/79 (74%)
 Frame = +1

Query: 256 TCSEQNFITKSGFQRYAAEHGVIVVGPDTSPRGVKIDGDDSSWDFGVSAGFYLDATNEPW 435
           TC+  NF+ KSGFQ++A++H ++VV PDTSPRGV +DGD  SWDFG  AGFY++AT E W
Sbjct: 55  TCTHANFMEKSGFQQFASKHRLVVVHPDTSPRGVDVDGDSESWDFGKGAGFYVNATVEKW 114

Query: 436 NNNYRMGSYLNVELYDLIL 492
             NYRM  Y+  EL + ++
Sbjct: 115 AKNYRMYDYIVKELLEEVV 133



 Score = 84.2 bits (199), Expect = 9e-17
 Identities = 37/69 (53%), Positives = 51/69 (73%), Gaps = 1/69 (1%)
 Frame = +3

Query: 561 ALVSTLRNPGQYKSVSAFAAICNPSACPWGVKAFSGYLG-EDKSKWAEWDATELVKKYNG 737
           AL   LRN  +++S+SAFA ICNP   PWG KA +GYLG EDKS W ++DA+E++K Y+G
Sbjct: 156 ALTIGLRNSSKFQSISAFAPICNPITVPWGQKALTGYLGDEDKSTWNQYDASEVLKAYSG 215

Query: 738 PPLTLLLDR 764
           P   +L+D+
Sbjct: 216 PKREILVDQ 224



 Score = 55.2 bits (127), Expect = 5e-08
 Identities = 27/51 (52%), Positives = 33/51 (64%)
 Frame = +2

Query: 101 LESSNKIFGGYQKVYSHASSELKCKMNFSIYLPPQAEGGDVKLPLLYYLSG 253
           L SSN+ F G Q VY HASS  +C+M F +Y+P      D KLP L+YLSG
Sbjct: 5   LVSSNRSFKGRQFVYKHASSTTQCEMTFGVYIPDHKP--DEKLPALFYLSG 53


>AL132948-2|CAC51076.2|  496|Caenorhabditis elegans Hypothetical
           protein Y39B6A.2 protein.
          Length = 496

 Score = 30.7 bits (66), Expect = 1.2
 Identities = 15/43 (34%), Positives = 22/43 (51%)
 Frame = -1

Query: 290 PDLVMKFCSLQVDQTNNIEVVISHHPLLPEGGDR*KNSFCILI 162
           PD+  K+C     +TN IE V+  H + PEG +   N  C  +
Sbjct: 407 PDVTSKWC-----ETNGIEYVVRSHEVKPEGYEMHHNGQCFTV 444


>U21321-10|AAG00048.2|  325|Caenorhabditis elegans T box family
           protein 35 protein.
          Length = 325

 Score = 28.7 bits (61), Expect = 4.8
 Identities = 14/44 (31%), Positives = 20/44 (45%)
 Frame = +2

Query: 35  LQDNCEYNFSGAHQKSNMDSLQLESSNKIFGGYQKVYSHASSEL 166
           L+ +C Y  S    K+N    Q     K +  Y KV +H  SE+
Sbjct: 63  LESDCLYKMSLRFDKTNNKRFQFNRQTKQWTEYDKVSNHKESEV 106


>Z81592-5|CAB04727.1|  434|Caenorhabditis elegans Hypothetical
           protein T16G1.5 protein.
          Length = 434

 Score = 28.3 bits (60), Expect = 6.4
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = +3

Query: 87  WTACN*NRPIKFLVVIKKCILMHHL 161
           WT  N N P K ++ +  CI +HHL
Sbjct: 65  WTIPNENLPEKIILKLTSCINVHHL 89


>AF040648-3|AAL06034.2|  453|Caenorhabditis elegans Hypothetical
           protein H19M22.3c protein.
          Length = 453

 Score = 28.3 bits (60), Expect = 6.4
 Identities = 8/17 (47%), Positives = 12/17 (70%)
 Frame = -2

Query: 448 CNYYSMVHLWRLNKNRH 398
           CN+ + +H+WR N N H
Sbjct: 373 CNFLAGLHMWRTNPNHH 389


>AF040648-1|AAK21412.1|  519|Caenorhabditis elegans Hypothetical
           protein H19M22.3a protein.
          Length = 519

 Score = 28.3 bits (60), Expect = 6.4
 Identities = 8/17 (47%), Positives = 12/17 (70%)
 Frame = -2

Query: 448 CNYYSMVHLWRLNKNRH 398
           CN+ + +H+WR N N H
Sbjct: 439 CNFLAGLHMWRTNPNHH 455


>AB007816-1|BAA28352.1|  394|Caenorhabditis elegans matrix
           metalloproteinase protein.
          Length = 394

 Score = 28.3 bits (60), Expect = 6.4
 Identities = 8/17 (47%), Positives = 12/17 (70%)
 Frame = -2

Query: 448 CNYYSMVHLWRLNKNRH 398
           CN+ + +H+WR N N H
Sbjct: 314 CNFLAGLHMWRTNPNHH 330


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,837,008
Number of Sequences: 27780
Number of extensions: 414110
Number of successful extensions: 1093
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 1045
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1089
length of database: 12,740,198
effective HSP length: 80
effective length of database: 10,517,798
effective search space used: 1851132448
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -