SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120021.Seq
         (683 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z92811-2|CAI46583.1|  299|Caenorhabditis elegans Hypothetical pr...    31   0.77 
Z82264-7|CAB05164.3|  499|Caenorhabditis elegans Hypothetical pr...    27   9.4  
U32275-1|AAA75370.1|  982|Caenorhabditis elegans serine-threonin...    27   9.4  
U11280-5|AAA19437.1|  982|Caenorhabditis elegans Protein kinase ...    27   9.4  
AC024806-3|AAP13749.1|  363|Caenorhabditis elegans Serpentine re...    27   9.4  

>Z92811-2|CAI46583.1|  299|Caenorhabditis elegans Hypothetical
           protein T01G1.4 protein.
          Length = 299

 Score = 31.1 bits (67), Expect = 0.77
 Identities = 17/67 (25%), Positives = 29/67 (43%), Gaps = 2/67 (2%)
 Frame = -3

Query: 264 ADRQHAYLHYYIFKNYGVFEYCKSLTDHSLFTNKLRSTMSTKTS--NLLLSKFKFTIEDF 91
           A   H Y    ++  +G F  CK++ ++  +   +    S+K S  N    K  F+  D 
Sbjct: 233 ASETHVYFDDVLWPEFGYFNLCKAILNYQYYRTTVTKMTSSKVSDDNATSWKMNFSGNDR 292

Query: 90  DKINSNS 70
           D I+  S
Sbjct: 293 DLISVKS 299


>Z82264-7|CAB05164.3|  499|Caenorhabditis elegans Hypothetical
           protein C49C3.13 protein.
          Length = 499

 Score = 27.5 bits (58), Expect = 9.4
 Identities = 13/37 (35%), Positives = 23/37 (62%), Gaps = 1/37 (2%)
 Frame = -1

Query: 449 EALVNFENDNC-NVRIAKTFGASKRKNTTRSDDYESN 342
           EA+ N ++DN  +  + KTFG +   +++ SD+  SN
Sbjct: 39  EAVKNLKDDNVLSKALVKTFGLNSSSSSSLSDESSSN 75


>U32275-1|AAA75370.1|  982|Caenorhabditis elegans serine-threonine
           kinase protein.
          Length = 982

 Score = 27.5 bits (58), Expect = 9.4
 Identities = 15/73 (20%), Positives = 31/73 (42%)
 Frame = -1

Query: 557 HKHSRRTHFVYRKRGGVLCSVDRPSIVKMLSREFDTEALVNFENDNCNVRIAKTFGASKR 378
           +KH R+ H    ++    C++DR  +   + RE + +    +  +   VR ++     KR
Sbjct: 541 YKHLRQAHHKELQQFEERCALDREQLRVKMDRELE-QLTTTYSKEKMRVRCSQNNELDKR 599

Query: 377 KNTTRSDDYESNK 339
           K      + +  K
Sbjct: 600 KKDIEDGEKKMKK 612


>U11280-5|AAA19437.1|  982|Caenorhabditis elegans Protein kinase
           protein 18, isoforma protein.
          Length = 982

 Score = 27.5 bits (58), Expect = 9.4
 Identities = 15/73 (20%), Positives = 31/73 (42%)
 Frame = -1

Query: 557 HKHSRRTHFVYRKRGGVLCSVDRPSIVKMLSREFDTEALVNFENDNCNVRIAKTFGASKR 378
           +KH R+ H    ++    C++DR  +   + RE + +    +  +   VR ++     KR
Sbjct: 541 YKHLRQAHHKELQQFEERCALDREQLRVKMDRELE-QLTTTYSKEKMRVRCSQNNELDKR 599

Query: 377 KNTTRSDDYESNK 339
           K      + +  K
Sbjct: 600 KKDIEDGEKKMKK 612


>AC024806-3|AAP13749.1|  363|Caenorhabditis elegans Serpentine
           receptor, class w protein40 protein.
          Length = 363

 Score = 27.5 bits (58), Expect = 9.4
 Identities = 15/38 (39%), Positives = 21/38 (55%)
 Frame = -3

Query: 237 YYIFKNYGVFEYCKSLTDHSLFTNKLRSTMSTKTSNLL 124
           YYIF+   + E C S T HS+    L + +S+   NLL
Sbjct: 96  YYIFQASFIHEKCTSPTSHSML---LLAVLSSSIRNLL 130


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,458,499
Number of Sequences: 27780
Number of extensions: 260805
Number of successful extensions: 704
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 693
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 704
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1560745544
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -