SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120020.Seq
         (726 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z78013-2|CAB01424.1|  453|Caenorhabditis elegans Hypothetical pr...    39   0.004
AL110478-6|CAE17957.2|  952|Caenorhabditis elegans Hypothetical ...    30   1.9  
U21309-3|AAN73880.2|  143|Caenorhabditis elegans Hypothetical pr...    29   3.4  
Z82284-4|CAB05288.1|  258|Caenorhabditis elegans Hypothetical pr...    28   7.8  
Z81067-5|CAD92378.1|  965|Caenorhabditis elegans Hypothetical pr...    28   7.8  
Z49128-2|CAA88959.1|  848|Caenorhabditis elegans Hypothetical pr...    28   7.8  
AC006757-3|AAF60541.2|  916|Caenorhabditis elegans Hypothetical ...    28   7.8  

>Z78013-2|CAB01424.1|  453|Caenorhabditis elegans Hypothetical
           protein F15B9.6 protein.
          Length = 453

 Score = 38.7 bits (86), Expect = 0.004
 Identities = 20/56 (35%), Positives = 31/56 (55%)
 Frame = +1

Query: 103 LLYNTVLTAILKQNNPFNVIAENTSISIIVRNLGNCPNNKDRVKCCDLNYGASRRD 270
           LLY  V+  I++ N P +V     + +I+  NLG CP   DR+K C   + +S R+
Sbjct: 4   LLYFIVIL-IIQANVPGSVQDSPEAYNILEPNLGGCPRTSDRIKFCSAKFNSSIRN 58


>AL110478-6|CAE17957.2|  952|Caenorhabditis elegans Hypothetical
            protein Y26D4A.14 protein.
          Length = 952

 Score = 29.9 bits (64), Expect = 1.9
 Identities = 21/66 (31%), Positives = 31/66 (46%), Gaps = 8/66 (12%)
 Frame = +1

Query: 7    NELKYPWNLI--TANSFIVSTDESRQSQYIYRTF------LLYNTVLTAILKQNNPFNVI 162
            N +K P N I   AN FIV T +     YIYR        + +N ++T++ K    F  I
Sbjct: 872  NYIKLPKNTIRENANFFIVFTQDKLNLDYIYRDHCGEIDKIKFNEMITSVWKDKYSFLTI 931

Query: 163  AENTSI 180
             + + I
Sbjct: 932  DKTSDI 937


>U21309-3|AAN73880.2|  143|Caenorhabditis elegans Hypothetical
           protein C13B9.1 protein.
          Length = 143

 Score = 29.1 bits (62), Expect = 3.4
 Identities = 11/27 (40%), Positives = 17/27 (62%)
 Frame = -1

Query: 171 IFSNYIKWIVLFENCGQNCIVQKKSAI 91
           I+ N  KW+ L  NC +N I+Q K ++
Sbjct: 79  IYGNLKKWLELILNCYRNIIIQTKKSM 105


>Z82284-4|CAB05288.1|  258|Caenorhabditis elegans Hypothetical
           protein T27E7.5 protein.
          Length = 258

 Score = 27.9 bits (59), Expect = 7.8
 Identities = 19/61 (31%), Positives = 32/61 (52%), Gaps = 1/61 (1%)
 Frame = +3

Query: 402 SLRENVNNQLHARDASQLHLLDWENFMGEFSSYFGLTHTTCSI-SNI*QLTYLLNKHSYF 578
           S R N+NN+ HA++  Q+H+      M   +S   +T   C+I S I Q   +++ + Y 
Sbjct: 161 SQRRNLNNKEHAKNPLQVHIFHQAMIM---TSIKAITVALCTIMSLIDQNLSVMDNYRYT 217

Query: 579 N 581
           N
Sbjct: 218 N 218


>Z81067-5|CAD92378.1|  965|Caenorhabditis elegans Hypothetical
           protein F23A7.7 protein.
          Length = 965

 Score = 27.9 bits (59), Expect = 7.8
 Identities = 11/27 (40%), Positives = 16/27 (59%)
 Frame = -1

Query: 171 IFSNYIKWIVLFENCGQNCIVQKKSAI 91
           I+ N  KW+ L  NC  N I+Q K ++
Sbjct: 203 IYGNLKKWLELILNCYGNIIIQTKKSM 229


>Z49128-2|CAA88959.1|  848|Caenorhabditis elegans Hypothetical
           protein M03C11.2 protein.
          Length = 848

 Score = 27.9 bits (59), Expect = 7.8
 Identities = 12/31 (38%), Positives = 21/31 (67%)
 Frame = +2

Query: 338 QQVQTIQRINCAPIRSRRRICEFTRKRKQPA 430
           +Q+Q+ +R+     ++RR + E +RKRK PA
Sbjct: 106 EQIQSRERLQSRIDQARRGMVEVSRKRKAPA 136


>AC006757-3|AAF60541.2|  916|Caenorhabditis elegans Hypothetical
            protein Y40C7B.1 protein.
          Length = 916

 Score = 27.9 bits (59), Expect = 7.8
 Identities = 22/66 (33%), Positives = 30/66 (45%), Gaps = 8/66 (12%)
 Frame = +1

Query: 7    NELKYPWNLI--TANSFIVSTDESRQSQYIYRTFL------LYNTVLTAILKQNNPFNVI 162
            N +K P N I   AN FIV T +     YIYR          +N ++T+I K    F  I
Sbjct: 836  NYIKLPKNTIRENANFFIVFTQDKLNLDYIYRDHCGEIDKSKFNEMVTSIWKVKYSFLTI 895

Query: 163  AENTSI 180
             + + I
Sbjct: 896  DKTSDI 901


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,733,781
Number of Sequences: 27780
Number of extensions: 321301
Number of successful extensions: 934
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 892
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 934
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1708383636
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -