SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120019.Seq
         (804 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z77654-2|CAB01130.1|  308|Caenorhabditis elegans Hypothetical pr...    31   0.97 
U72208-1|AAD00182.1|  308|Caenorhabditis elegans inhibitor of ap...    31   0.97 
U41296-1|AAA93297.1|  579|Caenorhabditis elegans Steroid hormone...    30   2.2  
AY204170-1|AAO39174.1|  579|Caenorhabditis elegans nuclear recep...    30   2.2  
AF067936-1|AAC19212.2|  579|Caenorhabditis elegans Nuclear hormo...    30   2.2  
Z82078-7|CAB04947.3|  801|Caenorhabditis elegans Hypothetical pr...    29   2.9  
Z74045-2|CAA98553.1|  155|Caenorhabditis elegans Hypothetical pr...    29   2.9  
U85911-1|AAB94330.1|  155|Caenorhabditis elegans inhibitor of ap...    29   2.9  
AF497514-1|AAM33381.1|  801|Caenorhabditis elegans heavy metal t...    29   2.9  
AF497513-1|AAM33380.1|  801|Caenorhabditis elegans heavy metal t...    29   2.9  
Z71185-5|CAA94911.1| 1078|Caenorhabditis elegans Hypothetical pr...    29   5.1  
U29097-10|AAA68414.1|  348|Caenorhabditis elegans Serpentine rec...    28   6.8  
Z70213-9|CAA94177.1| 1520|Caenorhabditis elegans Hypothetical pr...    28   9.0  
Z49069-5|CAA88867.1| 1520|Caenorhabditis elegans Hypothetical pr...    28   9.0  
Z29094-16|CAA82345.2|  184|Caenorhabditis elegans Hypothetical p...    28   9.0  
AF490977-1|AAQ06435.1|  801|Caenorhabditis elegans ABC6 protein ...    28   9.0  

>Z77654-2|CAB01130.1|  308|Caenorhabditis elegans Hypothetical
           protein C50B8.2 protein.
          Length = 308

 Score = 31.1 bits (67), Expect = 0.97
 Identities = 13/50 (26%), Positives = 25/50 (50%), Gaps = 2/50 (4%)
 Frame = +2

Query: 548 IAEAGLFYTGRGDETVCFFCDCCVRDWHINE--DAWQRHATENPQCYFVL 691
           +A AG + T   +      C  C+ + +  +  D W++H + +P C FV+
Sbjct: 49  LARAGFYSTASPEFPASAKCPFCMLEINFEQCDDPWEKHKSGSPHCEFVM 98


>U72208-1|AAD00182.1|  308|Caenorhabditis elegans inhibitor of
           apoptosis homolog protein.
          Length = 308

 Score = 31.1 bits (67), Expect = 0.97
 Identities = 13/50 (26%), Positives = 25/50 (50%), Gaps = 2/50 (4%)
 Frame = +2

Query: 548 IAEAGLFYTGRGDETVCFFCDCCVRDWHINE--DAWQRHATENPQCYFVL 691
           +A AG + T   +      C  C+ + +  +  D W++H + +P C FV+
Sbjct: 49  LARAGFYSTASPEFPASAKCPFCMLEINFEQCDDPWEKHKSGSPHCEFVM 98


>U41296-1|AAA93297.1|  579|Caenorhabditis elegans Steroid hormone
           receptor-like proteinprotein.
          Length = 579

 Score = 29.9 bits (64), Expect = 2.2
 Identities = 19/62 (30%), Positives = 27/62 (43%), Gaps = 1/62 (1%)
 Frame = -3

Query: 664 GGVSLPGVFVNMPITYATIAKETYSFVSATRVKKSRFRNVRNHVTQC-GRPKITNVSIRD 488
           G + LP  + N+P  YA+   + Y   +A    KS   N       C GRP   N++ R 
Sbjct: 349 GMIQLPTEYGNLPADYASWIPQDYGHPTAGHEGKSDMHNFFEARDFCVGRPSSCNLNERS 408

Query: 487 CK 482
            K
Sbjct: 409 MK 410


>AY204170-1|AAO39174.1|  579|Caenorhabditis elegans nuclear receptor
           NHR-47 protein.
          Length = 579

 Score = 29.9 bits (64), Expect = 2.2
 Identities = 19/62 (30%), Positives = 27/62 (43%), Gaps = 1/62 (1%)
 Frame = -3

Query: 664 GGVSLPGVFVNMPITYATIAKETYSFVSATRVKKSRFRNVRNHVTQC-GRPKITNVSIRD 488
           G + LP  + N+P  YA+   + Y   +A    KS   N       C GRP   N++ R 
Sbjct: 349 GMIQLPTEYGNLPADYASWIPQDYGHPTAGHEGKSDMHNFFEARDFCVGRPSSCNLNERS 408

Query: 487 CK 482
            K
Sbjct: 409 MK 410


>AF067936-1|AAC19212.2|  579|Caenorhabditis elegans Nuclear hormone
           receptor familyprotein 47 protein.
          Length = 579

 Score = 29.9 bits (64), Expect = 2.2
 Identities = 19/62 (30%), Positives = 27/62 (43%), Gaps = 1/62 (1%)
 Frame = -3

Query: 664 GGVSLPGVFVNMPITYATIAKETYSFVSATRVKKSRFRNVRNHVTQC-GRPKITNVSIRD 488
           G + LP  + N+P  YA+   + Y   +A    KS   N       C GRP   N++ R 
Sbjct: 349 GMIQLPTEYGNLPADYASWIPQDYGHPTAGHEGKSDMHNFFEARDFCVGRPSSCNLNERS 408

Query: 487 CK 482
            K
Sbjct: 409 MK 410


>Z82078-7|CAB04947.3|  801|Caenorhabditis elegans Hypothetical
           protein W09D6.6 protein.
          Length = 801

 Score = 29.5 bits (63), Expect = 2.9
 Identities = 17/67 (25%), Positives = 30/67 (44%)
 Frame = -2

Query: 350 VCIFNTLVFGPIFYFCFTILAHNVIVDLIVFKPLTIKLLINAVFTMG*FSNEPCLSSNMS 171
           +C    ++   IFYFCFT   H     L+ F    +   I ++ +   + N+P    +++
Sbjct: 76  ICTIFAVICQSIFYFCFTFYFHPYTHLLLAFCVSKLFFWILSLCSFSKWRNQPSTPISLA 135

Query: 170 NTCSAML 150
              SA L
Sbjct: 136 FAFSAAL 142


>Z74045-2|CAA98553.1|  155|Caenorhabditis elegans Hypothetical
           protein T27F2.3 protein.
          Length = 155

 Score = 29.5 bits (63), Expect = 2.9
 Identities = 15/47 (31%), Positives = 23/47 (48%)
 Frame = +2

Query: 548 IAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFV 688
           +A+AG + TG      C FC+  + D+   +D W  H   +  C FV
Sbjct: 42  VAQAGFYCTGP-QSGKCAFCNKEL-DFDPEDDPWYEHTKRDEPCEFV 86


>U85911-1|AAB94330.1|  155|Caenorhabditis elegans inhibitor of
           apoptosis homolog protein.
          Length = 155

 Score = 29.5 bits (63), Expect = 2.9
 Identities = 15/47 (31%), Positives = 23/47 (48%)
 Frame = +2

Query: 548 IAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFV 688
           +A+AG + TG      C FC+  + D+   +D W  H   +  C FV
Sbjct: 42  VAQAGFYCTGP-QSGKCAFCNKEL-DFDPEDDPWYEHTKRDEPCEFV 86


>AF497514-1|AAM33381.1|  801|Caenorhabditis elegans heavy metal
           tolerance factor 1 protein.
          Length = 801

 Score = 29.5 bits (63), Expect = 2.9
 Identities = 17/67 (25%), Positives = 30/67 (44%)
 Frame = -2

Query: 350 VCIFNTLVFGPIFYFCFTILAHNVIVDLIVFKPLTIKLLINAVFTMG*FSNEPCLSSNMS 171
           +C    ++   IFYFCFT   H     L+ F    +   I ++ +   + N+P    +++
Sbjct: 76  ICTIFAVICQSIFYFCFTFYFHPYTHLLLAFCVSKLFFWILSLCSFSKWRNQPSTPISLA 135

Query: 170 NTCSAML 150
              SA L
Sbjct: 136 FAFSAAL 142


>AF497513-1|AAM33380.1|  801|Caenorhabditis elegans heavy metal
           tolerance factor 1 protein.
          Length = 801

 Score = 29.5 bits (63), Expect = 2.9
 Identities = 17/67 (25%), Positives = 30/67 (44%)
 Frame = -2

Query: 350 VCIFNTLVFGPIFYFCFTILAHNVIVDLIVFKPLTIKLLINAVFTMG*FSNEPCLSSNMS 171
           +C    ++   IFYFCFT   H     L+ F    +   I ++ +   + N+P    +++
Sbjct: 76  ICTIFAVICQSIFYFCFTFYFHPYTHLLLAFCVSKLFFWILSLCSFSKWRNQPSTPISLA 135

Query: 170 NTCSAML 150
              SA L
Sbjct: 136 FAFSAAL 142


>Z71185-5|CAA94911.1| 1078|Caenorhabditis elegans Hypothetical protein
            C35A5.8 protein.
          Length = 1078

 Score = 28.7 bits (61), Expect = 5.1
 Identities = 27/127 (21%), Positives = 49/127 (38%)
 Frame = -3

Query: 673  RVFGGVSLPGVFVNMPITYATIAKETYSFVSATRVKKSRFRNVRNHVTQCGRPKITNVSI 494
            R++G   L          + +I ++   F S T++ ++ + N+  HV Q   P +TN+S+
Sbjct: 842  RLYGDSCLQDALTTFVKLFTSIPQD--DFHSYTKIAQNHY-NLLEHVVQDNMPFVTNLSV 898

Query: 493  RDCKLDMHLYTHLGLPSFTSTALMVMLSPNDSCSAILLAYAQYGDKVTCAYSIHSSSDQF 314
             D    +    H GL S  +  +    S  D+    L          T    +    D  
Sbjct: 899  -DVFCALLRSIHSGLSSVDAIVITSACSSLDTILNYLYRRLTRSTPPTNKVGMDPEGDNI 957

Query: 313  FISASQY 293
             I+  Q+
Sbjct: 958  LIAIKQH 964


>U29097-10|AAA68414.1|  348|Caenorhabditis elegans Serpentine
           receptor, class a (alpha)protein 29 protein.
          Length = 348

 Score = 28.3 bits (60), Expect = 6.8
 Identities = 16/58 (27%), Positives = 28/58 (48%)
 Frame = -2

Query: 335 TLVFGPIFYFCFTILAHNVIVDLIVFKPLTIKLLINAVFTMG*FSNEPCLSSNMSNTC 162
           TL +  +F FC   L  + IV+ I  +    ++ +  V+ +  +SN PC     S+ C
Sbjct: 46  TLWYKNVFPFCTKNLLLSAIVNGIFHQSTVAEIRLKTVYHLIRYSNAPCSILFQSSDC 103


>Z70213-9|CAA94177.1| 1520|Caenorhabditis elegans Hypothetical
           protein K12D12.1 protein.
          Length = 1520

 Score = 27.9 bits (59), Expect = 9.0
 Identities = 11/53 (20%), Positives = 24/53 (45%)
 Frame = +2

Query: 500 YVCNFWPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRH 658
           ++ +FWP+ ++          +    +G E V F+      +W +N D W+ +
Sbjct: 591 FIHHFWPSLIQRNFVEEFITPIVKATKGKEEVSFYSLPEYSEWRMNTDNWKSY 643


>Z49069-5|CAA88867.1| 1520|Caenorhabditis elegans Hypothetical
           protein K12D12.1 protein.
          Length = 1520

 Score = 27.9 bits (59), Expect = 9.0
 Identities = 11/53 (20%), Positives = 24/53 (45%)
 Frame = +2

Query: 500 YVCNFWPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRH 658
           ++ +FWP+ ++          +    +G E V F+      +W +N D W+ +
Sbjct: 591 FIHHFWPSLIQRNFVEEFITPIVKATKGKEEVSFYSLPEYSEWRMNTDNWKSY 643


>Z29094-16|CAA82345.2|  184|Caenorhabditis elegans Hypothetical
           protein C07A9.9 protein.
          Length = 184

 Score = 27.9 bits (59), Expect = 9.0
 Identities = 14/44 (31%), Positives = 20/44 (45%), Gaps = 4/44 (9%)
 Frame = +3

Query: 258 KYNQVDDHVV----CEYCEAEIKNWSEDECIEYAHVTLSPYCAY 377
           +Y  VDD V     C +C      W  D+C +  H +L  +C Y
Sbjct: 59  EYQYVDDDVPNSERCHFCMKRKGRWMGDDCSD--HSSLCKHCCY 100


>AF490977-1|AAQ06435.1|  801|Caenorhabditis elegans ABC6 protein
           protein.
          Length = 801

 Score = 27.9 bits (59), Expect = 9.0
 Identities = 17/67 (25%), Positives = 30/67 (44%)
 Frame = -2

Query: 350 VCIFNTLVFGPIFYFCFTILAHNVIVDLIVFKPLTIKLLINAVFTMG*FSNEPCLSSNMS 171
           +C    ++   IFYFCFT   H     L+ F    +   I ++ +   + N+P    +++
Sbjct: 76  ICTIFAVICQSIFYFCFTFYFHPYTHLLLAFCVSKLFFWILSLCSFLKWRNQPSTPISLA 135

Query: 170 NTCSAML 150
              SA L
Sbjct: 136 FAFSAAL 142


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,655,992
Number of Sequences: 27780
Number of extensions: 386599
Number of successful extensions: 1245
Number of sequences better than 10.0: 16
Number of HSP's better than 10.0 without gapping: 1205
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1245
length of database: 12,740,198
effective HSP length: 80
effective length of database: 10,517,798
effective search space used: 1966828226
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -