SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120018.Seq
         (789 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z82271-6|CAB05213.1| 1091|Caenorhabditis elegans Hypothetical pr...    72   4e-13
Z73102-19|CAA97421.1| 1091|Caenorhabditis elegans Hypothetical p...    72   4e-13
U80033-2|AAM15608.1| 1009|Caenorhabditis elegans Hypothetical pr...    63   3e-10
AL110471-3|CAB63308.1|  818|Caenorhabditis elegans Hypothetical ...    53   2e-07
AL034364-6|CAA22254.2|  818|Caenorhabditis elegans Hypothetical ...    53   2e-07
AL117204-6|CAB55149.2|  833|Caenorhabditis elegans Hypothetical ...    53   3e-07
U00032-5|AAA50636.2| 1009|Caenorhabditis elegans Yeast isw (imit...    45   7e-05
AL110477-9|CAB54333.1|  540|Caenorhabditis elegans Hypothetical ...    44   2e-04
Z68751-8|CAA92978.1| 1474|Caenorhabditis elegans Hypothetical pr...    42   4e-04
Z68341-5|CAA92768.1| 1474|Caenorhabditis elegans Hypothetical pr...    42   4e-04
AF230280-1|AAG16655.1| 1474|Caenorhabditis elegans SWI2/SNF2-lik...    42   4e-04
AF067617-5|AAC17559.1| 2957|Caenorhabditis elegans Temporarily a...    42   5e-04
Z49128-8|CAA88960.2|  989|Caenorhabditis elegans Hypothetical pr...    40   0.002
AL021171-6|CAA15960.2|  989|Caenorhabditis elegans Hypothetical ...    40   0.002
U41010-5|AAV28334.1|  975|Caenorhabditis elegans Hypothetical pr...    40   0.003
U41010-4|AAV28333.1| 1622|Caenorhabditis elegans Hypothetical pr...    40   0.003
AF016425-4|AAB65339.1|  518|Caenorhabditis elegans Hypothetical ...    39   0.004
Z81089-1|CAB03135.2|  957|Caenorhabditis elegans Hypothetical pr...    39   0.005
U64598-15|AAK39219.1| 1336|Caenorhabditis elegans Hypothetical p...    39   0.005
AY551965-1|AAS65429.1| 2395|Caenorhabditis elegans Swi/Snf famil...    38   0.006
AL132904-26|CAC35851.3| 2395|Caenorhabditis elegans Hypothetical...    38   0.006
Z92970-2|CAB07481.2| 1461|Caenorhabditis elegans Hypothetical pr...    38   0.011
U55373-1|AAC25894.1| 1829|Caenorhabditis elegans Lethal protein ...    37   0.019
AF308445-1|AAG29838.1| 1829|Caenorhabditis elegans LET-418 protein.    37   0.019
Z82079-1|CAB04949.1| 1529|Caenorhabditis elegans Hypothetical pr...    36   0.033
Z80344-7|CAB02491.1| 1529|Caenorhabditis elegans Hypothetical pr...    36   0.033
Z81089-5|CAD89731.2|  933|Caenorhabditis elegans Hypothetical pr...    33   0.23 
Z67884-5|CAA91810.1| 1787|Caenorhabditis elegans Hypothetical pr...    33   0.23 
Z67881-4|CAA91798.1| 1787|Caenorhabditis elegans Hypothetical pr...    33   0.23 
AF308444-1|AAG29837.1| 1787|Caenorhabditis elegans CHD-3 protein.      33   0.23 
U80437-15|AAB37627.1|  445|Caenorhabditis elegans Mus (drosophil...    33   0.31 
U42842-2|AAA83592.3|  341|Caenorhabditis elegans Hypothetical pr...    31   0.94 
U29488-13|AAA68780.1| 1599|Caenorhabditis elegans Hypothetical p...    31   0.94 
AF067948-4|AAO25983.1|  756|Caenorhabditis elegans Egl-27 relate...    30   1.6  
AF067948-3|AAO25984.1|  870|Caenorhabditis elegans Egl-27 relate...    30   1.6  
AF067948-2|AAD34654.1|  870|Caenorhabditis elegans Egl-27 relate...    30   1.6  
AF067948-1|AAD34653.1| 1022|Caenorhabditis elegans Egl-27 relate...    30   1.6  
AF134186-1|AAD55361.1| 1359|Caenorhabditis elegans XNP-1 protein.      30   2.2  
AF125442-5|AAD12795.1|  314|Caenorhabditis elegans Serpentine re...    30   2.2  
AF024503-1|AAG24089.2|  527|Caenorhabditis elegans Hypothetical ...    30   2.2  
AF000196-11|AAC24256.1| 1359|Caenorhabditis elegans Human xnp ge...    30   2.2  
Z83116-8|CAB05567.1|  397|Caenorhabditis elegans Hypothetical pr...    29   2.9  
U80028-8|AAN73866.1|  378|Caenorhabditis elegans Serpentine rece...    29   3.8  
AL110487-2|CAB54425.1|  445|Caenorhabditis elegans Hypothetical ...    29   3.8  
AL033510-4|CAA22070.2|  343|Caenorhabditis elegans Hypothetical ...    29   3.8  
Z68010-2|CAA92010.2|  433|Caenorhabditis elegans Hypothetical pr...    28   6.6  
AB236333-1|BAE45265.1|  433|Caenorhabditis elegans MBlk-1 Relate...    28   6.6  
Z81524-4|CAB04250.1|  528|Caenorhabditis elegans Hypothetical pr...    28   8.8  
Z70037-1|CAA93878.1|  493|Caenorhabditis elegans Hypothetical pr...    28   8.8  

>Z82271-6|CAB05213.1| 1091|Caenorhabditis elegans Hypothetical
           protein F54E12.2 protein.
          Length = 1091

 Score = 72.1 bits (169), Expect = 4e-13
 Identities = 28/69 (40%), Positives = 47/69 (68%), Gaps = 2/69 (2%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWK--MLNKNNDSTNRIKSIIKK 179
           L+A +RWC++GTPIHN  WD+YS++ FL+ RPF+D + WK  ++       +R+  + K 
Sbjct: 675 LSAFSRWCLSGTPIHNNLWDLYSLVRFLRIRPFSDDKYWKESIMPMKPIMADRVNLLTKN 734

Query: 180 IVLKRDKSE 206
           ++L+R K +
Sbjct: 735 LLLRRTKDQ 743



 Score = 64.1 bits (149), Expect = 1e-10
 Identities = 37/111 (33%), Positives = 57/111 (51%)
 Frame = +1

Query: 436  R*KSFGNKRLF*NGLYEQQVQTSAHLVDDILNTSDDKIILVSQWVEYLKIFENFFKQKNI 615
            R K     R+F       +++ +  +V++I+   + K+++VSQW   L + E   K    
Sbjct: 900  RDKPRATTRIFDPDYLSCKIKNTLEIVENIMEKKE-KVVIVSQWTSVLNLIEIHIKSSGF 958

Query: 616  ATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSIKCGGVGLNLIGGNTL 768
                 TGQ+ V+DR     +FN       R++LLS+  GGVGLNL GGN L
Sbjct: 959  KYTSITGQVLVKDRQERVDSFNREKGGA-RVMLLSLAAGGVGLNLTGGNHL 1008


>Z73102-19|CAA97421.1| 1091|Caenorhabditis elegans Hypothetical
           protein F54E12.2 protein.
          Length = 1091

 Score = 72.1 bits (169), Expect = 4e-13
 Identities = 28/69 (40%), Positives = 47/69 (68%), Gaps = 2/69 (2%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWK--MLNKNNDSTNRIKSIIKK 179
           L+A +RWC++GTPIHN  WD+YS++ FL+ RPF+D + WK  ++       +R+  + K 
Sbjct: 675 LSAFSRWCLSGTPIHNNLWDLYSLVRFLRIRPFSDDKYWKESIMPMKPIMADRVNLLTKN 734

Query: 180 IVLKRDKSE 206
           ++L+R K +
Sbjct: 735 LLLRRTKDQ 743



 Score = 64.1 bits (149), Expect = 1e-10
 Identities = 37/111 (33%), Positives = 57/111 (51%)
 Frame = +1

Query: 436  R*KSFGNKRLF*NGLYEQQVQTSAHLVDDILNTSDDKIILVSQWVEYLKIFENFFKQKNI 615
            R K     R+F       +++ +  +V++I+   + K+++VSQW   L + E   K    
Sbjct: 900  RDKPRATTRIFDPDYLSCKIKNTLEIVENIMEKKE-KVVIVSQWTSVLNLIEIHIKSSGF 958

Query: 616  ATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSIKCGGVGLNLIGGNTL 768
                 TGQ+ V+DR     +FN       R++LLS+  GGVGLNL GGN L
Sbjct: 959  KYTSITGQVLVKDRQERVDSFNREKGGA-RVMLLSLAAGGVGLNLTGGNHL 1008


>U80033-2|AAM15608.1| 1009|Caenorhabditis elegans Hypothetical
           protein T23H2.3 protein.
          Length = 1009

 Score = 62.9 bits (146), Expect = 3e-10
 Identities = 24/69 (34%), Positives = 43/69 (62%), Gaps = 2/69 (2%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVW--KMLNKNNDSTNRIKSIIKK 179
           L++ +RWC++GTPIHN  WD+YS++ FL+   F D + W   ++       +R+  + K 
Sbjct: 575 LSSFSRWCLSGTPIHNNLWDLYSLVRFLRIPLFGDRKFWAESIMPMKTGMADRVNLLTKN 634

Query: 180 IVLKRDKSE 206
           ++L+R K +
Sbjct: 635 LMLRRTKDQ 643



 Score = 58.0 bits (134), Expect = 7e-09
 Identities = 35/103 (33%), Positives = 54/103 (52%)
 Frame = +1

Query: 460  RLF*NGLYEQQVQTSAHLVDDILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQ 639
            R+F       ++  +  +V +IL   + K+++VSQW   L + E   +         TGQ
Sbjct: 814  RIFEPDFISCKMAKTLEVVREILEKKE-KVVIVSQWTSVLNLVEKHIQAGGHNYTSITGQ 872

Query: 640  LKVEDRILAETTFNNAADTQHRILLLSIKCGGVGLNLIGGNTL 768
            + V+DR     +FN       +++LLS+  GGVGLNLIGGN L
Sbjct: 873  VLVKDRQERVDSFNQEKGGA-QVMLLSLTAGGVGLNLIGGNHL 914



 Score = 30.3 bits (65), Expect = 1.6
 Identities = 15/42 (35%), Positives = 24/42 (57%)
 Frame = +2

Query: 353 SRLQQMQHVLWLILKLRQICCHPYLAMHGRNLLETNDCFKMD 478
           S  Q M  +L L+++LRQ C H ++   G +L    D FK++
Sbjct: 729 SNFQNMSCILLLLMRLRQACVHFHITKSGMDL----DAFKIN 766


>AL110471-3|CAB63308.1|  818|Caenorhabditis elegans Hypothetical
           protein W06D4.6 protein.
          Length = 818

 Score = 53.2 bits (122), Expect = 2e-07
 Identities = 30/79 (37%), Positives = 41/79 (51%)
 Frame = +1

Query: 532 TSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRIL 711
           T+DDK +LVS + + +  F    K +    +   G + ++ R     TFN+ A T     
Sbjct: 562 TTDDKFVLVSNYTQTIDQFMELCKLRGYDFVRLDGSMSIKQRSKIVDTFNDPASTIF-CF 620

Query: 712 LLSIKCGGVGLNLIGGNTL 768
           LLS K GG GLNLIG N L
Sbjct: 621 LLSSKAGGCGLNLIGANRL 639


>AL034364-6|CAA22254.2|  818|Caenorhabditis elegans Hypothetical
           protein W06D4.6 protein.
          Length = 818

 Score = 53.2 bits (122), Expect = 2e-07
 Identities = 30/79 (37%), Positives = 41/79 (51%)
 Frame = +1

Query: 532 TSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRIL 711
           T+DDK +LVS + + +  F    K +    +   G + ++ R     TFN+ A T     
Sbjct: 562 TTDDKFVLVSNYTQTIDQFMELCKLRGYDFVRLDGSMSIKQRSKIVDTFNDPASTIF-CF 620

Query: 712 LLSIKCGGVGLNLIGGNTL 768
           LLS K GG GLNLIG N L
Sbjct: 621 LLSSKAGGCGLNLIGANRL 639


>AL117204-6|CAB55149.2|  833|Caenorhabditis elegans Hypothetical
           protein Y116A8C.13 protein.
          Length = 833

 Score = 52.8 bits (121), Expect = 3e-07
 Identities = 29/73 (39%), Positives = 41/73 (56%)
 Frame = +1

Query: 550 ILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSIKC 729
           ++VS ++E L + +   +  N   L   G+ +V DR     TFN+  D  + I LLS K 
Sbjct: 537 VIVSNYIETLDMIQQLCEYLNFKVLRLDGKTQVPDRQKLVRTFNDHRDPSN-IFLLSTKA 595

Query: 730 GGVGLNLIGGNTL 768
           GGVGLNLIG + L
Sbjct: 596 GGVGLNLIGASRL 608



 Score = 33.1 bits (72), Expect = 0.23
 Identities = 18/81 (22%), Positives = 39/81 (48%)
 Frame = +3

Query: 3   ALTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKMLNKNNDSTNRIKSIIKKI 182
           +L    R  +TGTP+ N   + YS+++F+  RP     + +     +D   ++  +I + 
Sbjct: 361 SLEIPRRLILTGTPMQNDFEEFYSLLDFV--RPSVFGSIVEFRKMCSDRPEQLNELIDEC 418

Query: 183 VLKRDKSEISFNIPKHTVEYV 245
           +L+R  +++         EY+
Sbjct: 419 MLRRTAADVDLKHLPEKHEYI 439


>U00032-5|AAA50636.2| 1009|Caenorhabditis elegans Yeast isw
           (imitation swi) homologprotein 1 protein.
          Length = 1009

 Score = 44.8 bits (101), Expect = 7e-05
 Identities = 29/96 (30%), Positives = 54/96 (56%), Gaps = 7/96 (7%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPF---NDPRVW---KMLNKNNDSTNRIKS 167
           L + NR  ITGTP+ N   ++++++NFL    F   +D   W     ++ N D   R+  
Sbjct: 279 LNSENRLLITGTPLQNNLHELWALLNFLLPDIFTSSDDFDSWFSNDAMSGNTDLVQRLHK 338

Query: 168 IIKKIVLKRDKSEISFN-IPKHTVEYVHVNLMKKKK 272
           +++  +L+R KS++  + +PK  V+ V+V L K ++
Sbjct: 339 VLQPFLLRRIKSDVEKSLLPKKEVK-VYVGLSKMQR 373



 Score = 36.3 bits (80), Expect = 0.025
 Identities = 20/69 (28%), Positives = 37/69 (53%)
 Frame = +1

Query: 544 KIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSI 723
           ++++ SQ+   L + E+F   ++       G    EDR  A   +N A D++  I +L+ 
Sbjct: 453 RVLIFSQFSRMLDLLEDFCWWRHYEYCRLDGSTPHEDRSNAIEAYN-APDSKKFIFMLTT 511

Query: 724 KCGGVGLNL 750
           + GG+G+NL
Sbjct: 512 RAGGLGINL 520


>AL110477-9|CAB54333.1|  540|Caenorhabditis elegans Hypothetical
           protein Y113G7B.14 protein.
          Length = 540

 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 15/35 (42%), Positives = 22/35 (62%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFND 110
           L + NRWC+T  P  N  WD+ ++I FL  +PF +
Sbjct: 211 LASKNRWCVTAAPFQNSEWDICNLILFLGNKPFGE 245


>Z68751-8|CAA92978.1| 1474|Caenorhabditis elegans Hypothetical protein
            F01G4.1 protein.
          Length = 1474

 Score = 42.3 bits (95), Expect = 4e-04
 Identities = 30/102 (29%), Positives = 49/102 (48%), Gaps = 3/102 (2%)
 Frame = +1

Query: 472  NGLYEQQVQTSAHLVDDIL---NTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQL 642
            NG    +V     L+D IL     +  +I++  Q    + IFE+F   +    L   G  
Sbjct: 841  NGTDLMRVAGKLELLDRILPKLKATGHRILMFFQMTSMMNIFEDFLNFRRYTYLRLDGST 900

Query: 643  KVEDRILAETTFNNAADTQHRILLLSIKCGGVGLNLIGGNTL 768
            K ++R    T FN A ++   + +LS + GG+GLNL   +T+
Sbjct: 901  KPDERGDLLTQFN-APNSDLFLFMLSTRAGGLGLNLQTADTV 941



 Score = 34.7 bits (76), Expect = 0.076
 Identities = 27/94 (28%), Positives = 48/94 (51%), Gaps = 16/94 (17%)
 Frame = +3

Query: 12  ATNRWCITGTPIHNKHWDMYSMINFL------QC----RPFNDP--RVWKMLNKNNDST- 152
           A +R  +TGTP+ NK  ++++++NFL       C    + FN P     + +  N + T 
Sbjct: 682 AQHRLLLTGTPLQNKLPELWALLNFLLPSIFSSCGTFEQWFNAPFATTGEKVELNQEETM 741

Query: 153 ---NRIKSIIKKIVLKRDKSEISFNIPKHTVEYV 245
               R+  +++  +L+R K E+   +P  T EYV
Sbjct: 742 LIIRRLHKVLRPFLLRRLKKEVESQLPDKT-EYV 774


>Z68341-5|CAA92768.1| 1474|Caenorhabditis elegans Hypothetical protein
            F01G4.1 protein.
          Length = 1474

 Score = 42.3 bits (95), Expect = 4e-04
 Identities = 30/102 (29%), Positives = 49/102 (48%), Gaps = 3/102 (2%)
 Frame = +1

Query: 472  NGLYEQQVQTSAHLVDDIL---NTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQL 642
            NG    +V     L+D IL     +  +I++  Q    + IFE+F   +    L   G  
Sbjct: 841  NGTDLMRVAGKLELLDRILPKLKATGHRILMFFQMTSMMNIFEDFLNFRRYTYLRLDGST 900

Query: 643  KVEDRILAETTFNNAADTQHRILLLSIKCGGVGLNLIGGNTL 768
            K ++R    T FN A ++   + +LS + GG+GLNL   +T+
Sbjct: 901  KPDERGDLLTQFN-APNSDLFLFMLSTRAGGLGLNLQTADTV 941



 Score = 34.7 bits (76), Expect = 0.076
 Identities = 27/94 (28%), Positives = 48/94 (51%), Gaps = 16/94 (17%)
 Frame = +3

Query: 12  ATNRWCITGTPIHNKHWDMYSMINFL------QC----RPFNDP--RVWKMLNKNNDST- 152
           A +R  +TGTP+ NK  ++++++NFL       C    + FN P     + +  N + T 
Sbjct: 682 AQHRLLLTGTPLQNKLPELWALLNFLLPSIFSSCGTFEQWFNAPFATTGEKVELNQEETM 741

Query: 153 ---NRIKSIIKKIVLKRDKSEISFNIPKHTVEYV 245
               R+  +++  +L+R K E+   +P  T EYV
Sbjct: 742 LIIRRLHKVLRPFLLRRLKKEVESQLPDKT-EYV 774


>AF230280-1|AAG16655.1| 1474|Caenorhabditis elegans SWI2/SNF2-like
            protein protein.
          Length = 1474

 Score = 42.3 bits (95), Expect = 4e-04
 Identities = 30/102 (29%), Positives = 49/102 (48%), Gaps = 3/102 (2%)
 Frame = +1

Query: 472  NGLYEQQVQTSAHLVDDIL---NTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQL 642
            NG    +V     L+D IL     +  +I++  Q    + IFE+F   +    L   G  
Sbjct: 841  NGTDLMRVAGKLELLDRILPKLKATGHRILMFFQMTSMMNIFEDFLNFRRYTYLRLDGST 900

Query: 643  KVEDRILAETTFNNAADTQHRILLLSIKCGGVGLNLIGGNTL 768
            K ++R    T FN A ++   + +LS + GG+GLNL   +T+
Sbjct: 901  KPDERGDLLTQFN-APNSDLFLFMLSTRAGGLGLNLQTADTV 941



 Score = 34.7 bits (76), Expect = 0.076
 Identities = 27/94 (28%), Positives = 48/94 (51%), Gaps = 16/94 (17%)
 Frame = +3

Query: 12  ATNRWCITGTPIHNKHWDMYSMINFL------QC----RPFNDP--RVWKMLNKNNDST- 152
           A +R  +TGTP+ NK  ++++++NFL       C    + FN P     + +  N + T 
Sbjct: 682 AQHRLLLTGTPLQNKLPELWALLNFLLPSIFSSCGTFEQWFNAPFATTGEKVELNQEETM 741

Query: 153 ---NRIKSIIKKIVLKRDKSEISFNIPKHTVEYV 245
               R+  +++  +L+R K E+   +P  T EYV
Sbjct: 742 LIIRRLHKVLRPFLLRRLKKEVESQLPDKT-EYV 774


>AF067617-5|AAC17559.1| 2957|Caenorhabditis elegans Temporarily
            assigned gene nameprotein 192 protein.
          Length = 2957

 Score = 41.9 bits (94), Expect = 5e-04
 Identities = 26/94 (27%), Positives = 53/94 (56%), Gaps = 5/94 (5%)
 Frame = +3

Query: 3    ALTATNRWCITGTPIHNKHWDMYSMINFLQCRPF-NDPRVWKMLN--KNNDSTNRIKSII 173
            A    +R  +TGTP+ N   +++S++NFL  + F N     +     + +D   +++ I+
Sbjct: 1346 AFRMEHRVLLTGTPLQNNIDELFSLLNFLHPQQFDNSATFLEQFGSCQTDDQVQKLQEIL 1405

Query: 174  KKIVLKRDKSEISFNI-PK-HTVEYVHVNLMKKK 269
            K ++L+R K ++  ++ PK  T+  V ++ M+KK
Sbjct: 1406 KPMMLRRLKEDVEKSLGPKEETIIEVQLSDMQKK 1439



 Score = 33.5 bits (73), Expect = 0.18
 Identities = 20/81 (24%), Positives = 38/81 (46%)
 Frame = +1

Query: 526  LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
            L     K+++ SQ V+ L + E F    +       G ++ + R  A   F+   ++   
Sbjct: 1523 LRKDGHKVLIFSQMVKVLDLLEEFLISMSYPFERIDGNVRGDLRQAAIDRFSKE-NSDRF 1581

Query: 706  ILLLSIKCGGVGLNLIGGNTL 768
            + LL  + GG+G+NL   +T+
Sbjct: 1582 VFLLCTRAGGLGINLTAADTV 1602


>Z49128-8|CAA88960.2|  989|Caenorhabditis elegans Hypothetical
           protein M03C11.8 protein.
          Length = 989

 Score = 40.3 bits (90), Expect = 0.002
 Identities = 24/74 (32%), Positives = 36/74 (48%)
 Frame = +1

Query: 541 DKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLS 720
           DK+++ SQ+   L I E +   +  +     GQ  V DR      FN + D    + LLS
Sbjct: 770 DKVLIFSQFTSMLDILEVYLNIRGYSYKRLDGQTPVLDRQEMINEFNLSKDLF--VFLLS 827

Query: 721 IKCGGVGLNLIGGN 762
            + GG+G+NL   N
Sbjct: 828 TRAGGLGINLTSAN 841


>AL021171-6|CAA15960.2|  989|Caenorhabditis elegans Hypothetical
           protein M03C11.8 protein.
          Length = 989

 Score = 40.3 bits (90), Expect = 0.002
 Identities = 24/74 (32%), Positives = 36/74 (48%)
 Frame = +1

Query: 541 DKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLS 720
           DK+++ SQ+   L I E +   +  +     GQ  V DR      FN + D    + LLS
Sbjct: 770 DKVLIFSQFTSMLDILEVYLNIRGYSYKRLDGQTPVLDRQEMINEFNLSKDLF--VFLLS 827

Query: 721 IKCGGVGLNLIGGN 762
            + GG+G+NL   N
Sbjct: 828 TRAGGLGINLTSAN 841


>U41010-5|AAV28334.1|  975|Caenorhabditis elegans Hypothetical
           protein T05A12.4b protein.
          Length = 975

 Score = 39.5 bits (88), Expect = 0.003
 Identities = 16/37 (43%), Positives = 21/37 (56%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPR 116
           L A N WC+TGTP+      +Y + NFL   PF  P+
Sbjct: 546 LHAENWWCVTGTPLVKSIAGIYPLFNFLNLFPFGSPQ 582


>U41010-4|AAV28333.1| 1622|Caenorhabditis elegans Hypothetical
           protein T05A12.4a protein.
          Length = 1622

 Score = 39.5 bits (88), Expect = 0.003
 Identities = 16/37 (43%), Positives = 21/37 (56%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPR 116
           L A N WC+TGTP+      +Y + NFL   PF  P+
Sbjct: 546 LHAENWWCVTGTPLVKSIAGIYPLFNFLNLFPFGSPQ 582


>AF016425-4|AAB65339.1|  518|Caenorhabditis elegans Hypothetical
           protein F59A7.8 protein.
          Length = 518

 Score = 39.1 bits (87), Expect = 0.004
 Identities = 21/46 (45%), Positives = 28/46 (60%)
 Frame = +1

Query: 631 TGQLKVEDRILAETTFNNAADTQHRILLLSIKCGGVGLNLIGGNTL 768
           TG++ ++DR     +FN         +LLS+  GGVGLNLIGGN L
Sbjct: 386 TGEVAIKDRQERVDSFNQEKGGAQD-MLLSLTAGGVGLNLIGGNHL 430



 Score = 32.3 bits (70), Expect = 0.41
 Identities = 10/16 (62%), Positives = 15/16 (93%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHN 53
           ++A +RWC++GTPIHN
Sbjct: 306 ISAFSRWCLSGTPIHN 321


>Z81089-1|CAB03135.2|  957|Caenorhabditis elegans Hypothetical
           protein F53H4.1 protein.
          Length = 957

 Score = 38.7 bits (86), Expect = 0.005
 Identities = 24/91 (26%), Positives = 43/91 (47%)
 Frame = +1

Query: 490 QVQTSAHLVDDILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAE 669
           +V+ +  L DD   +  +++IL +Q    + + E F  +K I  +  TG      R    
Sbjct: 522 KVEMTFKLFDDWFKSPTNRVILFTQRRTVITMMEYFLAEKGIKCVSLTGADSAAARPKII 581

Query: 670 TTFNNAADTQHRILLLSIKCGGVGLNLIGGN 762
             F +  D   ++ L++ + GG+GLNL   N
Sbjct: 582 KKFED--DVSIKVFLMTTRAGGLGLNLTCAN 610


>U64598-15|AAK39219.1| 1336|Caenorhabditis elegans Hypothetical
           protein C52B9.8 protein.
          Length = 1336

 Score = 38.7 bits (86), Expect = 0.005
 Identities = 22/81 (27%), Positives = 41/81 (50%)
 Frame = +1

Query: 526 LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
           L  +  ++++  Q    + I E+F     I  L   G  K ++R      FN A ++++ 
Sbjct: 695 LQATGHRVLMFFQMTSMMTIVEDFLAGGTIQYLRLDGSTKPDERGALLDKFN-APNSEYF 753

Query: 706 ILLLSIKCGGVGLNLIGGNTL 768
           + +LS + GG+GLNL   +T+
Sbjct: 754 LFMLSTRAGGLGLNLQTADTV 774



 Score = 29.1 bits (62), Expect = 3.8
 Identities = 11/23 (47%), Positives = 18/23 (78%)
 Frame = +3

Query: 21  RWCITGTPIHNKHWDMYSMINFL 89
           R  ITGTP+ NK  ++++++NFL
Sbjct: 518 RLLITGTPLQNKLPELWALLNFL 540


>AY551965-1|AAS65429.1| 2395|Caenorhabditis elegans Swi/Snf family
            ATPase protein.
          Length = 2395

 Score = 38.3 bits (85), Expect = 0.006
 Identities = 25/100 (25%), Positives = 51/100 (51%), Gaps = 13/100 (13%)
 Frame = +3

Query: 12   ATNRWCITGTPIHNKHWDMYSMINFLQCRPF---NDPRVW------KMLNKNNDST---- 152
            A  R  +TGTP+ N   +++S+++FL    F   +D + W       M+  N +      
Sbjct: 707  ARRRLLLTGTPLQNSLMELWSLMHFLMPTIFSSHDDFKDWFSNPLTGMMEGNMEFNAPLI 766

Query: 153  NRIKSIIKKIVLKRDKSEISFNIPKHTVEYVHVNLMKKKK 272
             R+  +++  +L+R K E+   +P+ T   V+ +L K+++
Sbjct: 767  GRLHKVLRPFILRRLKKEVEKQLPEKTEHIVNCSLSKRQR 806



 Score = 35.1 bits (77), Expect = 0.058
 Identities = 21/75 (28%), Positives = 34/75 (45%)
 Frame = +1

Query: 544  KIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSI 723
            + ++ +Q  + L + + F            G   VE R      FN  AD +    +LS 
Sbjct: 1206 RCLIFTQMSKMLDVLQTFLSHHGYQYFRLDGTTGVEQRQAMMERFN--ADPKVFCFILST 1263

Query: 724  KCGGVGLNLIGGNTL 768
            + GGVG+NL G +T+
Sbjct: 1264 RSGGVGVNLTGADTV 1278


>AL132904-26|CAC35851.3| 2395|Caenorhabditis elegans Hypothetical
            protein Y111B2A.22 protein.
          Length = 2395

 Score = 38.3 bits (85), Expect = 0.006
 Identities = 25/100 (25%), Positives = 51/100 (51%), Gaps = 13/100 (13%)
 Frame = +3

Query: 12   ATNRWCITGTPIHNKHWDMYSMINFLQCRPF---NDPRVW------KMLNKNNDST---- 152
            A  R  +TGTP+ N   +++S+++FL    F   +D + W       M+  N +      
Sbjct: 707  ARRRLLLTGTPLQNSLMELWSLMHFLMPTIFSSHDDFKDWFSNPLTGMMEGNMEFNAPLI 766

Query: 153  NRIKSIIKKIVLKRDKSEISFNIPKHTVEYVHVNLMKKKK 272
             R+  +++  +L+R K E+   +P+ T   V+ +L K+++
Sbjct: 767  GRLHKVLRPFILRRLKKEVEKQLPEKTEHIVNCSLSKRQR 806



 Score = 35.1 bits (77), Expect = 0.058
 Identities = 21/75 (28%), Positives = 34/75 (45%)
 Frame = +1

Query: 544  KIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSI 723
            + ++ +Q  + L + + F            G   VE R      FN  AD +    +LS 
Sbjct: 1206 RCLIFTQMSKMLDVLQTFLSHHGYQYFRLDGTTGVEQRQAMMERFN--ADPKVFCFILST 1263

Query: 724  KCGGVGLNLIGGNTL 768
            + GGVG+NL G +T+
Sbjct: 1264 RSGGVGVNLTGADTV 1278


>Z92970-2|CAB07481.2| 1461|Caenorhabditis elegans Hypothetical protein
            H06O01.2 protein.
          Length = 1461

 Score = 37.5 bits (83), Expect = 0.011
 Identities = 27/103 (26%), Positives = 50/103 (48%), Gaps = 5/103 (4%)
 Frame = +1

Query: 475  GLYEQQVQTSAHLV--DDILNTSDDK---IILVSQWVEYLKIFENFFKQKNIATLMYTGQ 639
            G  +Q +++S  L+  D +L    DK   +++ SQ V  L I + + + +   +    G 
Sbjct: 701  GRLQQLLKSSGKLILLDKLLCRLKDKGHRVLIFSQMVMMLDILQEYLQLRRFPSQRLDGS 760

Query: 640  LKVEDRILAETTFNNAADTQHRILLLSIKCGGVGLNLIGGNTL 768
            ++ + R  A   +N    T    LL S + GG+G+NL   +T+
Sbjct: 761  MRADLRKQALDHYNAPGSTDFAFLL-STRAGGLGINLATADTV 802



 Score = 36.3 bits (80), Expect = 0.025
 Identities = 20/87 (22%), Positives = 49/87 (56%), Gaps = 5/87 (5%)
 Frame = +3

Query: 30  ITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKMLNKNNDSTNR--IKSIIKKI---VLKR 194
           ITGTP+ N   +++++++F+    F+    W+     ++ +N   I ++ KK+   +L+R
Sbjct: 565 ITGTPLQNSLKELWALLHFIMPEKFD---CWEEFETAHNESNHKGISALHKKLEPFLLRR 621

Query: 195 DKSEISFNIPKHTVEYVHVNLMKKKKR 275
            K ++  ++P  T + + V++   +K+
Sbjct: 622 VKKDVEKSLPPKTEQILRVDMTAHQKQ 648


>U55373-1|AAC25894.1| 1829|Caenorhabditis elegans Lethal protein 418
            protein.
          Length = 1829

 Score = 36.7 bits (81), Expect = 0.019
 Identities = 21/88 (23%), Positives = 44/88 (50%), Gaps = 3/88 (3%)
 Frame = +3

Query: 21   RWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKM-LNK--NNDSTNRIKSIIKKIVLK 191
            R  +TGTP+ N   +++ ++NFL    FN    +    N+    D   ++ +++   +L+
Sbjct: 773  RVLLTGTPLQNNLEELFHLLNFLSKERFNQLEAFTAEFNEISKEDQIEKLHNLLGPHMLR 832

Query: 192  RDKSEISFNIPKHTVEYVHVNLMKKKKR 275
            R K+++   +P  +   V V L   +K+
Sbjct: 833  RLKADVLTGMPSKSELIVRVELSAMQKK 860



 Score = 33.1 bits (72), Expect = 0.23
 Identities = 22/81 (27%), Positives = 37/81 (45%)
 Frame = +1

Query: 526  LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
            L     ++++ SQ    L I E+  + +        G +  + R  A   +N A   Q  
Sbjct: 938  LKDGGHRVLIFSQMTRMLDIMEDLCEYEGYRYERIDGSIMGQMRQDAIDRYN-APGAQQF 996

Query: 706  ILLLSIKCGGVGLNLIGGNTL 768
            I LLS + GG+G+NL   +T+
Sbjct: 997  IFLLSTRAGGLGINLATADTV 1017


>AF308445-1|AAG29838.1| 1829|Caenorhabditis elegans LET-418 protein.
          Length = 1829

 Score = 36.7 bits (81), Expect = 0.019
 Identities = 21/88 (23%), Positives = 44/88 (50%), Gaps = 3/88 (3%)
 Frame = +3

Query: 21   RWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKM-LNK--NNDSTNRIKSIIKKIVLK 191
            R  +TGTP+ N   +++ ++NFL    FN    +    N+    D   ++ +++   +L+
Sbjct: 773  RVLLTGTPLQNNLEELFHLLNFLSKERFNQLEAFTAEFNEISKEDQIEKLHNLLGPHMLR 832

Query: 192  RDKSEISFNIPKHTVEYVHVNLMKKKKR 275
            R K+++   +P  +   V V L   +K+
Sbjct: 833  RLKADVLTGMPSKSELIVRVELSAMQKK 860



 Score = 33.1 bits (72), Expect = 0.23
 Identities = 22/81 (27%), Positives = 37/81 (45%)
 Frame = +1

Query: 526  LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
            L     ++++ SQ    L I E+  + +        G +  + R  A   +N A   Q  
Sbjct: 938  LKDGGHRVLIFSQMTRMLDIMEDLCEYEGYRYERIDGSIMGQMRQDAIDRYN-APGAQQF 996

Query: 706  ILLLSIKCGGVGLNLIGGNTL 768
            I LLS + GG+G+NL   +T+
Sbjct: 997  IFLLSTRAGGLGINLATADTV 1017


>Z82079-1|CAB04949.1| 1529|Caenorhabditis elegans Hypothetical protein
            F15D4.1 protein.
          Length = 1529

 Score = 35.9 bits (79), Expect = 0.033
 Identities = 24/85 (28%), Positives = 39/85 (45%), Gaps = 4/85 (4%)
 Frame = +1

Query: 526  LNTSDDKIILVSQWVEYLKIFENFFKQKN----IATLMYTGQLKVEDRILAETTFNNAAD 693
            L  S  + ++  QW    K+  +  K       ++ L+  G +   DR+     FN   D
Sbjct: 1316 LVASGHRALIFCQWKTSAKLVSDALKSGEFGSVVSHLVLDGSVPAGDRMKMVNRFNE--D 1373

Query: 694  TQHRILLLSIKCGGVGLNLIGGNTL 768
                +L+L+   GGVGLNL G +T+
Sbjct: 1374 KTIDVLILTTHVGGVGLNLTGADTV 1398


>Z80344-7|CAB02491.1| 1529|Caenorhabditis elegans Hypothetical protein
            F15D4.1 protein.
          Length = 1529

 Score = 35.9 bits (79), Expect = 0.033
 Identities = 24/85 (28%), Positives = 39/85 (45%), Gaps = 4/85 (4%)
 Frame = +1

Query: 526  LNTSDDKIILVSQWVEYLKIFENFFKQKN----IATLMYTGQLKVEDRILAETTFNNAAD 693
            L  S  + ++  QW    K+  +  K       ++ L+  G +   DR+     FN   D
Sbjct: 1316 LVASGHRALIFCQWKTSAKLVSDALKSGEFGSVVSHLVLDGSVPAGDRMKMVNRFNE--D 1373

Query: 694  TQHRILLLSIKCGGVGLNLIGGNTL 768
                +L+L+   GGVGLNL G +T+
Sbjct: 1374 KTIDVLILTTHVGGVGLNLTGADTV 1398


>Z81089-5|CAD89731.2|  933|Caenorhabditis elegans Hypothetical
           protein F53H4.6 protein.
          Length = 933

 Score = 33.1 bits (72), Expect = 0.23
 Identities = 20/70 (28%), Positives = 31/70 (44%)
 Frame = +1

Query: 490 QVQTSAHLVDDILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAE 669
           +V+    L+D  L T   K+++ +Q  +   + E+F KQK IA   +       DR    
Sbjct: 539 KVRIVFQLLDMWLGTPGAKVVIFTQRRQVAVMLEHFMKQKRIAYCSFLKAKNAYDRENVV 598

Query: 670 TTFNNAADTQ 699
             F N  D Q
Sbjct: 599 NYFENTTDVQ 608


>Z67884-5|CAA91810.1| 1787|Caenorhabditis elegans Hypothetical protein
            T14G8.1 protein.
          Length = 1787

 Score = 33.1 bits (72), Expect = 0.23
 Identities = 21/89 (23%), Positives = 44/89 (49%), Gaps = 4/89 (4%)
 Frame = +3

Query: 21   RWCITGTPIHNKHWDMYSMINFLQCRPFND----PRVWKMLNKNNDSTNRIKSIIKKIVL 188
            R  +TGTP+ N   +++ ++NFL    FN        +  ++K  D   ++ +++   +L
Sbjct: 787  RVLLTGTPLQNNLEELFHLLNFLAPDRFNQLESFTAEFSEISK-EDQIEKLHNLLGPHML 845

Query: 189  KRDKSEISFNIPKHTVEYVHVNLMKKKKR 275
            +R K+++   +P      V V L   +K+
Sbjct: 846  RRLKADVLTGMPSKQELIVRVELSAMQKK 874



 Score = 32.7 bits (71), Expect = 0.31
 Identities = 21/81 (25%), Positives = 37/81 (45%)
 Frame = +1

Query: 526  LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
            L     ++++ SQ    L I E+F   +        G +  + R  A   +N A   +  
Sbjct: 952  LKDGGHRVLIFSQMTMMLDILEDFCDVEGYKYERIDGSITGQQRQDAIDRYN-APGAKQF 1010

Query: 706  ILLLSIKCGGVGLNLIGGNTL 768
            + LLS + GG+G+NL   +T+
Sbjct: 1011 VFLLSTRAGGLGINLATADTV 1031


>Z67881-4|CAA91798.1| 1787|Caenorhabditis elegans Hypothetical protein
            T14G8.1 protein.
          Length = 1787

 Score = 33.1 bits (72), Expect = 0.23
 Identities = 21/89 (23%), Positives = 44/89 (49%), Gaps = 4/89 (4%)
 Frame = +3

Query: 21   RWCITGTPIHNKHWDMYSMINFLQCRPFND----PRVWKMLNKNNDSTNRIKSIIKKIVL 188
            R  +TGTP+ N   +++ ++NFL    FN        +  ++K  D   ++ +++   +L
Sbjct: 787  RVLLTGTPLQNNLEELFHLLNFLAPDRFNQLESFTAEFSEISK-EDQIEKLHNLLGPHML 845

Query: 189  KRDKSEISFNIPKHTVEYVHVNLMKKKKR 275
            +R K+++   +P      V V L   +K+
Sbjct: 846  RRLKADVLTGMPSKQELIVRVELSAMQKK 874



 Score = 32.7 bits (71), Expect = 0.31
 Identities = 21/81 (25%), Positives = 37/81 (45%)
 Frame = +1

Query: 526  LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
            L     ++++ SQ    L I E+F   +        G +  + R  A   +N A   +  
Sbjct: 952  LKDGGHRVLIFSQMTMMLDILEDFCDVEGYKYERIDGSITGQQRQDAIDRYN-APGAKQF 1010

Query: 706  ILLLSIKCGGVGLNLIGGNTL 768
            + LLS + GG+G+NL   +T+
Sbjct: 1011 VFLLSTRAGGLGINLATADTV 1031


>AF308444-1|AAG29837.1| 1787|Caenorhabditis elegans CHD-3 protein.
          Length = 1787

 Score = 33.1 bits (72), Expect = 0.23
 Identities = 21/89 (23%), Positives = 44/89 (49%), Gaps = 4/89 (4%)
 Frame = +3

Query: 21   RWCITGTPIHNKHWDMYSMINFLQCRPFND----PRVWKMLNKNNDSTNRIKSIIKKIVL 188
            R  +TGTP+ N   +++ ++NFL    FN        +  ++K  D   ++ +++   +L
Sbjct: 787  RVLLTGTPLQNNLEELFHLLNFLAPDRFNQLESFTAEFSEISK-EDQIEKLHNLLGPHML 845

Query: 189  KRDKSEISFNIPKHTVEYVHVNLMKKKKR 275
            +R K+++   +P      V V L   +K+
Sbjct: 846  RRLKADVLTGMPSKQELIVRVELSAMQKK 874



 Score = 32.7 bits (71), Expect = 0.31
 Identities = 21/81 (25%), Positives = 37/81 (45%)
 Frame = +1

Query: 526  LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
            L     ++++ SQ    L I E+F   +        G +  + R  A   +N A   +  
Sbjct: 952  LKDGGHRVLIFSQMTMMLDILEDFCDVEGYKYERIDGSITGQQRQDAIDRYN-APGAKQF 1010

Query: 706  ILLLSIKCGGVGLNLIGGNTL 768
            + LLS + GG+G+NL   +T+
Sbjct: 1011 VFLLSTRAGGLGINLATADTV 1031


>U80437-15|AAB37627.1|  445|Caenorhabditis elegans Mus (drosophila
           mutagen sensitive)related protein 81, isoform a protein.
          Length = 445

 Score = 32.7 bits (71), Expect = 0.31
 Identities = 15/38 (39%), Positives = 23/38 (60%), Gaps = 1/38 (2%)
 Frame = +3

Query: 87  LQCRPFNDPRVWKML-NKNNDSTNRIKSIIKKIVLKRD 197
           L CRPF  P V+ +  N+ + +  R KS+I+ +V K D
Sbjct: 199 LTCRPFEQPTVYLIADNREHRNNPRFKSVIEHLVKKED 236


>U42842-2|AAA83592.3|  341|Caenorhabditis elegans Hypothetical
           protein EGAP2.1 protein.
          Length = 341

 Score = 31.1 bits (67), Expect = 0.94
 Identities = 17/58 (29%), Positives = 28/58 (48%), Gaps = 1/58 (1%)
 Frame = +3

Query: 216 NIPKHTVEYVHVNLMKKKKRCTIS*NVNRKRRI*KLWQ-RVKAKTR*ADCSKCSTCYG 386
           N PK     +   L+KK+++C     +   RR    ++ R + K +  DCS CS  +G
Sbjct: 75  NYPKIVTTMMQRGLLKKRQQCRKCDRMMHLRRRKNCYEWRCRTKDKRGDCSSCSIKFG 132


>U29488-13|AAA68780.1| 1599|Caenorhabditis elegans Hypothetical
            protein C56C10.12 protein.
          Length = 1599

 Score = 31.1 bits (67), Expect = 0.94
 Identities = 22/81 (27%), Positives = 36/81 (44%)
 Frame = -2

Query: 671  VSAKILSSTFNWPVYINVAMFFCLKKFSNIFKYSTHCETNIILSSLVFKMSSTK*ALVCT 492
            V++ +L S      Y NV +    K F   F+   H +        +   SST   +V  
Sbjct: 955  VASVVLLSRLIAQHYQNVNLMAADKNFMTTFERLLHIDQLPYAVQWLSGPSSTPTPIVKL 1014

Query: 491  CCSYNPF*NSRLFPKDFYRAW 429
             CS   + +++L P+D+ RAW
Sbjct: 1015 ICSAISYYSAKLPPRDYLRAW 1035


>AF067948-4|AAO25983.1|  756|Caenorhabditis elegans Egl-27 related
           protein 1, isoform c protein.
          Length = 756

 Score = 30.3 bits (65), Expect = 1.6
 Identities = 14/29 (48%), Positives = 20/29 (68%)
 Frame = +2

Query: 260 EEEKTLYDKLKCESEEAYMKAVAARESEN 346
           +E K L +K+K E EEA +KA A  ++EN
Sbjct: 303 KEAKVLAEKVKKEEEEAKLKAEAEEDTEN 331


>AF067948-3|AAO25984.1|  870|Caenorhabditis elegans Egl-27 related
           protein 1, isoform d protein.
          Length = 870

 Score = 30.3 bits (65), Expect = 1.6
 Identities = 14/29 (48%), Positives = 20/29 (68%)
 Frame = +2

Query: 260 EEEKTLYDKLKCESEEAYMKAVAARESEN 346
           +E K L +K+K E EEA +KA A  ++EN
Sbjct: 303 KEAKVLAEKVKKEEEEAKLKAEAEEDTEN 331


>AF067948-2|AAD34654.1|  870|Caenorhabditis elegans Egl-27 related
           protein 1, isoform b protein.
          Length = 870

 Score = 30.3 bits (65), Expect = 1.6
 Identities = 14/29 (48%), Positives = 20/29 (68%)
 Frame = +2

Query: 260 EEEKTLYDKLKCESEEAYMKAVAARESEN 346
           +E K L +K+K E EEA +KA A  ++EN
Sbjct: 303 KEAKVLAEKVKKEEEEAKLKAEAEEDTEN 331


>AF067948-1|AAD34653.1| 1022|Caenorhabditis elegans Egl-27 related
           protein 1, isoform a protein.
          Length = 1022

 Score = 30.3 bits (65), Expect = 1.6
 Identities = 14/29 (48%), Positives = 20/29 (68%)
 Frame = +2

Query: 260 EEEKTLYDKLKCESEEAYMKAVAARESEN 346
           +E K L +K+K E EEA +KA A  ++EN
Sbjct: 303 KEAKVLAEKVKKEEEEAKLKAEAEEDTEN 331


>AF134186-1|AAD55361.1| 1359|Caenorhabditis elegans XNP-1 protein.
          Length = 1359

 Score = 29.9 bits (64), Expect = 2.2
 Identities = 10/24 (41%), Positives = 17/24 (70%)
 Frame = +3

Query: 21  RWCITGTPIHNKHWDMYSMINFLQ 92
           R C+TGTP+ N   + + M+NF++
Sbjct: 660 RICLTGTPLQNNLMEYHCMVNFVK 683


>AF125442-5|AAD12795.1|  314|Caenorhabditis elegans Serpentine
           receptor, class v protein22 protein.
          Length = 314

 Score = 29.9 bits (64), Expect = 2.2
 Identities = 12/50 (24%), Positives = 24/50 (48%)
 Frame = -3

Query: 271 FFFFIKLTCTYSTVCLGMLKEISDLSRFKTIFLIILFMRFVESLFLFNIF 122
           +F F+ +T  Y  + + +L+       FKT F +IL    +  +F  + +
Sbjct: 30  YFLFVTVTPVYILILICILRARRSSVTFKTTFYVILIQHSIADIFALSFY 79


>AF024503-1|AAG24089.2|  527|Caenorhabditis elegans Hypothetical
           protein F31F4.7 protein.
          Length = 527

 Score = 29.9 bits (64), Expect = 2.2
 Identities = 22/60 (36%), Positives = 25/60 (41%)
 Frame = -2

Query: 446 DFYRAWPNTGGSRFASISVLAITRAAFAAIGLACFRFHALPQLSYTPLPIHILTYRTTFF 267
           DF R W   G       S L  T+   +  G   FR HALPQ+ Y  L  H   Y   FF
Sbjct: 93  DFSRYWTQEGTLLETIPSYLMFTK--MSDHGYETFRNHALPQMEY--LKSHRPRYDAVFF 148


>AF000196-11|AAC24256.1| 1359|Caenorhabditis elegans Human xnp gene
           related protein 1 protein.
          Length = 1359

 Score = 29.9 bits (64), Expect = 2.2
 Identities = 10/24 (41%), Positives = 17/24 (70%)
 Frame = +3

Query: 21  RWCITGTPIHNKHWDMYSMINFLQ 92
           R C+TGTP+ N   + + M+NF++
Sbjct: 660 RICLTGTPLQNNLMEYHCMVNFVK 683


>Z83116-8|CAB05567.1|  397|Caenorhabditis elegans Hypothetical
           protein M01B2.10 protein.
          Length = 397

 Score = 29.5 bits (63), Expect = 2.9
 Identities = 14/48 (29%), Positives = 23/48 (47%)
 Frame = -3

Query: 271 FFFFIKLTCTYSTVCLGMLKEISDLSRFKTIFLIILFMRFVESLFLFN 128
           FFF ++L  + +T      K    L   +T+F I  F  F +++F  N
Sbjct: 26  FFFLLRLFLSNNTCEFSSFKRFGKLRDTETLFFISNFQSFFQTIFKLN 73


>U80028-8|AAN73866.1|  378|Caenorhabditis elegans Serpentine
           receptor, class w protein118 protein.
          Length = 378

 Score = 29.1 bits (62), Expect = 3.8
 Identities = 21/83 (25%), Positives = 40/83 (48%), Gaps = 2/83 (2%)
 Frame = -3

Query: 280 VQRFFFFIKLTCTYSTVCLGMLKEISDLSRFKTIFLI-ILFMRFVESLFLFNIF-HTLGS 107
           +  FF   + +   S++ + ++  ++    F ++  I ILF R+  S   F+ F  T G 
Sbjct: 54  IVHFFILTRKSMRTSSINI-LMAAVALFDIFTSLIEIQILFERY--SFIFFSCFPETYGK 110

Query: 106 LKGRHCKKLIIEYISQCLLWIGV 38
           +  RH   L+ +Y  +C  W+ V
Sbjct: 111 VLNRHLLHLLKDYSRRCSTWLMV 133


>AL110487-2|CAB54425.1|  445|Caenorhabditis elegans Hypothetical
           protein Y39E4B.2 protein.
          Length = 445

 Score = 29.1 bits (62), Expect = 3.8
 Identities = 19/58 (32%), Positives = 29/58 (50%)
 Frame = -3

Query: 202 DLSRFKTIFLIILFMRFVESLFLFNIFHTLGSLKGRHCKKLIIEYISQCLLWIGVPVM 29
           DL+ F   +L    +RF +   +F     +G   GRH    IIE+ ++CLL   +P M
Sbjct: 19  DLNSFLRAYLQFESVRFFDYKVMFENRGMVGLFTGRHNSAEIIEF-NECLLVHCLPYM 75


>AL033510-4|CAA22070.2|  343|Caenorhabditis elegans Hypothetical
           protein Y40H7A.6 protein.
          Length = 343

 Score = 29.1 bits (62), Expect = 3.8
 Identities = 18/49 (36%), Positives = 26/49 (53%), Gaps = 4/49 (8%)
 Frame = -2

Query: 407 FASISVLAITRAAFAAIGLACFRFHALPQL----SYTPLPIHILTYRTT 273
           F+ +S +A+T A    IGL+ + FH + Q      Y  L I +L YR T
Sbjct: 262 FSCLSSVAVTIARAFEIGLSEYTFHTMTQFIAGPLYGNLSIPVLIYRKT 310


>Z68010-2|CAA92010.2|  433|Caenorhabditis elegans Hypothetical
           protein T01C1.2 protein.
          Length = 433

 Score = 28.3 bits (60), Expect = 6.6
 Identities = 23/87 (26%), Positives = 40/87 (45%), Gaps = 2/87 (2%)
 Frame = +3

Query: 33  TGTPIHNKHWDMYSMINFLQCRPFNDPRVWKMLNKNNDSTNRIKSIIKKIVLKRDKSEIS 212
           T TPI  K   M+    + + RP      ++  +KN  + +     +++  +   ++   
Sbjct: 313 TPTPISEKSQKMHGNEEWKRSRPKRGQ--YRKYDKN--ALDEAVRSVRRGEMTVHRAGSF 368

Query: 213 FNIPKHTVEYV--HVNLMKKKKRCTIS 287
           F +P  T+EY     NLM+KKK C  S
Sbjct: 369 FGVPHSTLEYKVKERNLMRKKKDCLYS 395


>AB236333-1|BAE45265.1|  433|Caenorhabditis elegans MBlk-1 Related
           factor-1 protein.
          Length = 433

 Score = 28.3 bits (60), Expect = 6.6
 Identities = 23/87 (26%), Positives = 40/87 (45%), Gaps = 2/87 (2%)
 Frame = +3

Query: 33  TGTPIHNKHWDMYSMINFLQCRPFNDPRVWKMLNKNNDSTNRIKSIIKKIVLKRDKSEIS 212
           T TPI  K   M+    + + RP      ++  +KN  + +     +++  +   ++   
Sbjct: 313 TPTPISEKSQKMHGNEEWKRSRPKRGQ--YRKYDKN--ALDEAVRSVRRGEMTVHRAGSF 368

Query: 213 FNIPKHTVEYV--HVNLMKKKKRCTIS 287
           F +P  T+EY     NLM+KKK C  S
Sbjct: 369 FGVPHSTLEYKVKERNLMRKKKDCLYS 395


>Z81524-4|CAB04250.1|  528|Caenorhabditis elegans Hypothetical
           protein F32H5.4 protein.
          Length = 528

 Score = 27.9 bits (59), Expect = 8.8
 Identities = 15/63 (23%), Positives = 28/63 (44%)
 Frame = -3

Query: 235 TVCLGMLKEISDLSRFKTIFLIILFMRFVESLFLFNIFHTLGSLKGRHCKKLIIEYISQC 56
           +VC  M+  +S L+ F    +    +R + S+F   +  T G  K  H  +    +I+  
Sbjct: 151 SVCFFMVSSLSILNTFAKDLIYFTIIRTILSIFKGGLLSTYGVYKMEHVPRQHRFWIATM 210

Query: 55  LLW 47
           + W
Sbjct: 211 ISW 213


>Z70037-1|CAA93878.1|  493|Caenorhabditis elegans Hypothetical
           protein T27D12.1 protein.
          Length = 493

 Score = 27.9 bits (59), Expect = 8.8
 Identities = 15/48 (31%), Positives = 23/48 (47%)
 Frame = -2

Query: 734 PPHLIESSKIRC*VSAALLNVVSAKILSSTFNWPVYINVAMFFCLKKF 591
           PP L  SSK+ C  ++  L  +S  +    FN   ++  A F C+  F
Sbjct: 306 PPFLQFSSKLICGAASDRLTCLSEGVKFRLFNTLAFVGSAGFLCVLAF 353


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,343,188
Number of Sequences: 27780
Number of extensions: 391852
Number of successful extensions: 1360
Number of sequences better than 10.0: 49
Number of HSP's better than 10.0 without gapping: 1260
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1352
length of database: 12,740,198
effective HSP length: 80
effective length of database: 10,517,798
effective search space used: 1914239236
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -