SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120017.Seq
         (731 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AC024790-4|AAF60636.1|  121|Caenorhabditis elegans Hypothetical ...    37   0.017
AC024790-5|AAF60640.2|  119|Caenorhabditis elegans Hypothetical ...    36   0.039
Z83217-2|CAB05680.2|  319|Caenorhabditis elegans Hypothetical pr...    31   1.1  
AC024853-4|AAK68586.1|  746|Caenorhabditis elegans Hypothetical ...    31   1.1  
Z73907-1|CAA98124.1| 4753|Caenorhabditis elegans Hypothetical pr...    30   1.5  
M96150-1|AAA28105.1| 4753|Caenorhabditis elegans LDL receptor-re...    30   1.5  
AL032626-17|CAA21536.1|  282|Caenorhabditis elegans Hypothetical...    30   1.9  
Z46791-5|CAA86755.2|  948|Caenorhabditis elegans Hypothetical pr...    29   3.4  
Z81028-2|CAB02694.1|  996|Caenorhabditis elegans Hypothetical pr...    29   4.5  
U40410-3|AAL27230.1| 1169|Caenorhabditis elegans Lin-12 and glp-...    29   4.5  
U40410-2|AAL27229.1| 1876|Caenorhabditis elegans Lin-12 and glp-...    29   4.5  
U18546-1|AAB02615.1|  996|Caenorhabditis elegans Na,K-ATPase alp...    29   4.5  
AF003135-11|AAK18987.2| 1406|Caenorhabditis elegans Hypothetical...    29   4.5  
AC024790-10|AAF60632.2|  129|Caenorhabditis elegans Hypothetical...    29   4.5  
Z70034-10|CAI79119.2|  560|Caenorhabditis elegans Hypothetical p...    28   5.9  
Z70034-3|CAA93860.2|  620|Caenorhabditis elegans Hypothetical pr...    28   5.9  
Z70034-2|CAA93854.3|  623|Caenorhabditis elegans Hypothetical pr...    28   5.9  
U56860-5|AAP40524.1|  685|Caenorhabditis elegans Intermediate fi...    28   5.9  
U56860-4|AAM69100.1| 1128|Caenorhabditis elegans Intermediate fi...    28   5.9  
U56860-3|AAM69101.1| 1248|Caenorhabditis elegans Intermediate fi...    28   5.9  
U15406-1|AAA50456.1| 2272|Caenorhabditis elegans gag, pol and en...    28   5.9  
L23646-13|AAA28035.2| 2175|Caenorhabditis elegans C. elegans RET...    28   5.9  
L23646-12|AAL02516.1| 2186|Caenorhabditis elegans C. elegans RET...    28   5.9  
AF067617-5|AAC17559.1| 2957|Caenorhabditis elegans Temporarily a...    28   5.9  
Z81056-1|CAB02902.1|  319|Caenorhabditis elegans Hypothetical pr...    28   7.8  
U80448-6|AAO12417.1|  687|Caenorhabditis elegans Hypothetical pr...    28   7.8  
U80448-5|AAB37819.1|  975|Caenorhabditis elegans Hypothetical pr...    28   7.8  
AC024824-3|AAK85501.1|  543|Caenorhabditis elegans Hypothetical ...    28   7.8  

>AC024790-4|AAF60636.1|  121|Caenorhabditis elegans Hypothetical
           protein Y47D7A.7 protein.
          Length = 121

 Score = 36.7 bits (81), Expect = 0.017
 Identities = 24/70 (34%), Positives = 33/70 (47%), Gaps = 8/70 (11%)
 Frame = +1

Query: 22  NFYYNTPPPPLRYPSNPATAIFTNAQTYNNAPGY--VPP------TTRDNKMDTSRSNST 177
           N Y  TP  P   PS P    +  A TY + P Y   PP      T+ DN+ DT   ++T
Sbjct: 24  NSYPTTPSYPTPPPSYPTPKKYPVAPTYPSTPSYSAQPPPAPSAYTSSDNQEDTESESAT 83

Query: 178 NSVAIAPYNK 207
           ++ A + Y K
Sbjct: 84  SASATSEYRK 93


>AC024790-5|AAF60640.2|  119|Caenorhabditis elegans Hypothetical
           protein Y47D7A.2 protein.
          Length = 119

 Score = 35.5 bits (78), Expect = 0.039
 Identities = 22/68 (32%), Positives = 31/68 (45%), Gaps = 6/68 (8%)
 Frame = +1

Query: 22  NFYYNTPPPPLRYPSNPATAIFTNAQTYNNAPGY-VPP-----TTRDNKMDTSRSNSTNS 183
           N Y  TP  P   PS P    +  A TY + P Y  PP     ++ DN+ DT   + T +
Sbjct: 24  NSYPTTPSYPTPPPSYPTPKKYPVAPTYPSTPSYSAPPAQSAYSSSDNQEDTESESVTGA 83

Query: 184 VAIAPYNK 207
            + + Y K
Sbjct: 84  ASTSEYRK 91


>Z83217-2|CAB05680.2|  319|Caenorhabditis elegans Hypothetical
           protein C10C6.3 protein.
          Length = 319

 Score = 30.7 bits (66), Expect = 1.1
 Identities = 14/43 (32%), Positives = 21/43 (48%)
 Frame = +1

Query: 88  TNAQTYNNAPGYVPPTTRDNKMDTSRSNSTNSVAIAPYNKSKE 216
           TN  T  +  GYVPP  ++      +    N+VA+ P  K K+
Sbjct: 151 TNVYT-GSREGYVPPPAKEGSGSGGKKKDMNNVAVKPDEKKKD 192


>AC024853-4|AAK68586.1|  746|Caenorhabditis elegans Hypothetical
           protein Y71F9AR.3 protein.
          Length = 746

 Score = 30.7 bits (66), Expect = 1.1
 Identities = 18/51 (35%), Positives = 27/51 (52%), Gaps = 2/51 (3%)
 Frame = +1

Query: 22  NFYYNTPP--PPLRYPSNPATAIFTNAQTYNNAPGYVPPTTRDNKMDTSRS 168
           +F+ N  P  P  R  S P+++ F+N+   N      PPTT D   +TSR+
Sbjct: 184 DFFANELPSTPSEREASPPSSSQFSNSAAPNLPETKQPPTTTDQYSETSRT 234


>Z73907-1|CAA98124.1| 4753|Caenorhabditis elegans Hypothetical protein
            F29D11.1 protein.
          Length = 4753

 Score = 30.3 bits (65), Expect = 1.5
 Identities = 13/41 (31%), Positives = 24/41 (58%)
 Frame = +1

Query: 34   NTPPPPLRYPSNPATAIFTNAQTYNNAPGYVPPTTRDNKMD 156
            ++PPP    PS  A+A+  N  + + A  +VPPT   ++++
Sbjct: 4666 SSPPPSNDQPSTSASAMSPNRPSTSAASSFVPPTFDQDEIE 4706


>M96150-1|AAA28105.1| 4753|Caenorhabditis elegans LDL receptor-related
            protein protein.
          Length = 4753

 Score = 30.3 bits (65), Expect = 1.5
 Identities = 13/41 (31%), Positives = 24/41 (58%)
 Frame = +1

Query: 34   NTPPPPLRYPSNPATAIFTNAQTYNNAPGYVPPTTRDNKMD 156
            ++PPP    PS  A+A+  N  + + A  +VPPT   ++++
Sbjct: 4666 SSPPPSNDQPSTSASAMSPNRPSTSAASSFVPPTFDQDEIE 4706


>AL032626-17|CAA21536.1|  282|Caenorhabditis elegans Hypothetical
           protein Y37D8A.21 protein.
          Length = 282

 Score = 29.9 bits (64), Expect = 1.9
 Identities = 16/56 (28%), Positives = 24/56 (42%)
 Frame = +3

Query: 81  HIHQRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTDARRRRIYLV 248
           H   +   QQ  R    Y+ R QN    +   + G DR+  +  R D RRR  + +
Sbjct: 190 HFVNQMMQQQINRSAPPYNGRHQNSTPHRHHDRHGYDRSSSRHHRNDDRRRSAHFL 245


>Z46791-5|CAA86755.2|  948|Caenorhabditis elegans Hypothetical
           protein C09G5.6 protein.
          Length = 948

 Score = 29.1 bits (62), Expect = 3.4
 Identities = 17/61 (27%), Positives = 23/61 (37%)
 Frame = +1

Query: 1   SMTDERGNFYYNTPPPPLRYPSNPATAIFTNAQTYNNAPGYVPPTTRDNKMDTSRSNSTN 180
           S  + R + Y   PPP   YP+NP          Y   P Y      DN+     + S N
Sbjct: 187 SSPNNRTSLYNPQPPPKTGYPTNPRVPYNPPQPNYTRQPTY----PEDNRAPYKPTRSPN 242

Query: 181 S 183
           +
Sbjct: 243 T 243


>Z81028-2|CAB02694.1|  996|Caenorhabditis elegans Hypothetical
           protein B0365.3 protein.
          Length = 996

 Score = 28.7 bits (61), Expect = 4.5
 Identities = 22/69 (31%), Positives = 30/69 (43%), Gaps = 2/69 (2%)
 Frame = +2

Query: 392 KAV*IGGDHDTPPDSVAKRVGTRQRGRVPAERFEYISGIFVLNSLPAYAQKFYNGGADM- 568
           K V + GDH     ++AK VG    G    E      GI V    P  A+     G+D+ 
Sbjct: 585 KVVMVTGDHPITAKAIAKSVGIISDGTETVEDIAIRRGIPVEEVNPREAKAAVIHGSDLR 644

Query: 569 -LGKDALAE 592
            + +D LAE
Sbjct: 645 EMSEDQLAE 653


>U40410-3|AAL27230.1| 1169|Caenorhabditis elegans Lin-12 and glp-1
           x-hybridizingprotein 1, isoform b protein.
          Length = 1169

 Score = 28.7 bits (61), Expect = 4.5
 Identities = 14/43 (32%), Positives = 19/43 (44%)
 Frame = +1

Query: 25  FYYNTPPPPLRYPSNPATAIFTNAQTYNNAPGYVPPTTRDNKM 153
           F+  T PP   Y + PAT  F   Q Y   P     + + N+M
Sbjct: 389 FFQTTRPPMPTYATTPATTQFIPKQIYTTPPQMPKNSIKINQM 431


>U40410-2|AAL27229.1| 1876|Caenorhabditis elegans Lin-12 and glp-1
           x-hybridizingprotein 1, isoform a protein.
          Length = 1876

 Score = 28.7 bits (61), Expect = 4.5
 Identities = 14/43 (32%), Positives = 19/43 (44%)
 Frame = +1

Query: 25  FYYNTPPPPLRYPSNPATAIFTNAQTYNNAPGYVPPTTRDNKM 153
           F+  T PP   Y + PAT  F   Q Y   P     + + N+M
Sbjct: 486 FFQTTRPPMPTYATTPATTQFIPKQIYTTPPQMPKNSIKINQM 528


>U18546-1|AAB02615.1|  996|Caenorhabditis elegans Na,K-ATPase alpha
           subunit protein.
          Length = 996

 Score = 28.7 bits (61), Expect = 4.5
 Identities = 22/69 (31%), Positives = 30/69 (43%), Gaps = 2/69 (2%)
 Frame = +2

Query: 392 KAV*IGGDHDTPPDSVAKRVGTRQRGRVPAERFEYISGIFVLNSLPAYAQKFYNGGADM- 568
           K V + GDH     ++AK VG    G    E      GI V    P  A+     G+D+ 
Sbjct: 585 KVVMVTGDHPITAKAIAKSVGIISDGTETVEDIAIRRGIPVEEVNPREAKAAVIHGSDLR 644

Query: 569 -LGKDALAE 592
            + +D LAE
Sbjct: 645 EMSEDQLAE 653


>AF003135-11|AAK18987.2| 1406|Caenorhabditis elegans Hypothetical
           protein W03F11.4 protein.
          Length = 1406

 Score = 28.7 bits (61), Expect = 4.5
 Identities = 13/42 (30%), Positives = 20/42 (47%)
 Frame = +1

Query: 43  PPPLRYPSNPATAIFTNAQTYNNAPGYVPPTTRDNKMDTSRS 168
           PPP   P + A ++        NAP   P TT  ++ ++S S
Sbjct: 833 PPPAPQPPSSAASLTPAPSAAQNAPSIAPSTTEASEEESSGS 874


>AC024790-10|AAF60632.2|  129|Caenorhabditis elegans Hypothetical
           protein Y47D7A.11 protein.
          Length = 129

 Score = 28.7 bits (61), Expect = 4.5
 Identities = 17/54 (31%), Positives = 21/54 (38%), Gaps = 1/54 (1%)
 Frame = +1

Query: 31  YNTPPPPLRYPSN-PATAIFTNAQTYNNAPGYVPPTTRDNKMDTSRSNSTNSVA 189
           Y TPPP    P   P    + +   Y   P Y  P      + +S S S N VA
Sbjct: 32  YPTPPPSYPTPKKYPVAPTYPSPPAYAQKPSYSAPPPPAPSVYSSSSFSDNEVA 85


>Z70034-10|CAI79119.2|  560|Caenorhabditis elegans Hypothetical
           protein C18E9.3c protein.
          Length = 560

 Score = 28.3 bits (60), Expect = 5.9
 Identities = 13/45 (28%), Positives = 22/45 (48%)
 Frame = +3

Query: 78  GHIHQRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQ 212
           G +H + N  Q  +++      QQ  H+P QQH+   +  V  +Q
Sbjct: 330 GQLHHQMNAGQLHQIQQQQQQCQQIQHQPPQQHQQVINGQVMNQQ 374


>Z70034-3|CAA93860.2|  620|Caenorhabditis elegans Hypothetical
           protein C18E9.3b protein.
          Length = 620

 Score = 28.3 bits (60), Expect = 5.9
 Identities = 13/45 (28%), Positives = 22/45 (48%)
 Frame = +3

Query: 78  GHIHQRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQ 212
           G +H + N  Q  +++      QQ  H+P QQH+   +  V  +Q
Sbjct: 390 GQLHHQMNAGQLHQIQQQQQQCQQIQHQPPQQHQQVINGQVMNQQ 434


>Z70034-2|CAA93854.3|  623|Caenorhabditis elegans Hypothetical
           protein C18E9.3a protein.
          Length = 623

 Score = 28.3 bits (60), Expect = 5.9
 Identities = 13/45 (28%), Positives = 22/45 (48%)
 Frame = +3

Query: 78  GHIHQRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQ 212
           G +H + N  Q  +++      QQ  H+P QQH+   +  V  +Q
Sbjct: 393 GQLHHQMNAGQLHQIQQQQQQCQQIQHQPPQQHQQVINGQVMNQQ 437


>U56860-5|AAP40524.1|  685|Caenorhabditis elegans Intermediate
           filament, c protein2, isoform c protein.
          Length = 685

 Score = 28.3 bits (60), Expect = 5.9
 Identities = 11/31 (35%), Positives = 21/31 (67%)
 Frame = +3

Query: 141 RQQNGHEPQQQHKLGSDRTVQQEQRTDARRR 233
           RQ+ G++ QQQH+    +T +QE++ +  +R
Sbjct: 290 RQEQGYQQQQQHRSREYKTHRQEKQENYNQR 320


>U56860-4|AAM69100.1| 1128|Caenorhabditis elegans Intermediate
           filament, c protein2, isoform a protein.
          Length = 1128

 Score = 28.3 bits (60), Expect = 5.9
 Identities = 11/31 (35%), Positives = 21/31 (67%)
 Frame = +3

Query: 141 RQQNGHEPQQQHKLGSDRTVQQEQRTDARRR 233
           RQ+ G++ QQQH+    +T +QE++ +  +R
Sbjct: 290 RQEQGYQQQQQHRSREYKTHRQEKQENYNQR 320


>U56860-3|AAM69101.1| 1248|Caenorhabditis elegans Intermediate
           filament, c protein2, isoform b protein.
          Length = 1248

 Score = 28.3 bits (60), Expect = 5.9
 Identities = 11/31 (35%), Positives = 21/31 (67%)
 Frame = +3

Query: 141 RQQNGHEPQQQHKLGSDRTVQQEQRTDARRR 233
           RQ+ G++ QQQH+    +T +QE++ +  +R
Sbjct: 290 RQEQGYQQQQQHRSREYKTHRQEKQENYNQR 320


>U15406-1|AAA50456.1| 2272|Caenorhabditis elegans gag, pol and env
           protein precursor protein.
          Length = 2272

 Score = 28.3 bits (60), Expect = 5.9
 Identities = 16/44 (36%), Positives = 22/44 (50%)
 Frame = +1

Query: 85  FTNAQTYNNAPGYVPPTTRDNKMDTSRSNSTNSVAIAPYNKSKE 216
           F N  T NN   + P    DN  ++  +NS N+ A A  N S+E
Sbjct: 570 FVNQNTQNNFKPFSPNKAADNSRNSWNNNSQNNSA-ASQNISRE 612


>L23646-13|AAA28035.2| 2175|Caenorhabditis elegans C. elegans RETR-1
           protein, isoforma protein.
          Length = 2175

 Score = 28.3 bits (60), Expect = 5.9
 Identities = 16/44 (36%), Positives = 22/44 (50%)
 Frame = +1

Query: 85  FTNAQTYNNAPGYVPPTTRDNKMDTSRSNSTNSVAIAPYNKSKE 216
           F N  T NN   + P    DN  ++  +NS N+ A A  N S+E
Sbjct: 473 FVNQNTQNNFKPFSPNKAADNSRNSWNNNSQNNSA-ASQNISRE 515


>L23646-12|AAL02516.1| 2186|Caenorhabditis elegans C. elegans RETR-1
           protein, isoformb protein.
          Length = 2186

 Score = 28.3 bits (60), Expect = 5.9
 Identities = 16/44 (36%), Positives = 22/44 (50%)
 Frame = +1

Query: 85  FTNAQTYNNAPGYVPPTTRDNKMDTSRSNSTNSVAIAPYNKSKE 216
           F N  T NN   + P    DN  ++  +NS N+ A A  N S+E
Sbjct: 484 FVNQNTQNNFKPFSPNKAADNSRNSWNNNSQNNSA-ASQNISRE 526


>AF067617-5|AAC17559.1| 2957|Caenorhabditis elegans Temporarily
            assigned gene nameprotein 192 protein.
          Length = 2957

 Score = 28.3 bits (60), Expect = 5.9
 Identities = 22/95 (23%), Positives = 40/95 (42%), Gaps = 2/95 (2%)
 Frame = -3

Query: 663  GMGMLHVTDSATMYWTAKLSCLPASAKASLPNISAPPL*NFCAYAGS--EFSTKMPEIYS 490
            G+GM  +    TM   A++  +    + SLP    PP+ +   +  S  E+S  +P +++
Sbjct: 2535 GVGMQELAKLNTMSKDARVPMIHKQTRESLPVSKRPPIRDLTVFVMSNPEWSIDIP-LFN 2593

Query: 489  NRSAGTRPRCLVPTLFATESGGVSWSPPIQTALPR 385
              S         P+  A  S     + P+  A P+
Sbjct: 2594 EMSGNGTGSGAAPSSKAASSRPTPAATPLAVATPK 2628


>Z81056-1|CAB02902.1|  319|Caenorhabditis elegans Hypothetical
           protein F09F3.1 protein.
          Length = 319

 Score = 27.9 bits (59), Expect = 7.8
 Identities = 11/39 (28%), Positives = 18/39 (46%)
 Frame = +3

Query: 255 CVDFVQKIIRYYRCNDMSELSPLMIHFINTIRDMCIDTN 371
           C       + YY    M  +SPL  + +NT+  +C+  N
Sbjct: 80  CATLTFSQVNYYLNRTMGMVSPLWSYILNTLIPICLSCN 118


>U80448-6|AAO12417.1|  687|Caenorhabditis elegans Hypothetical
           protein F59A3.2b protein.
          Length = 687

 Score = 27.9 bits (59), Expect = 7.8
 Identities = 21/67 (31%), Positives = 29/67 (43%), Gaps = 4/67 (5%)
 Frame = +1

Query: 43  PPPLRYPSNPATAIFTNAQTYNNAPGYVPPTTRDNK--MDTSRSNSTNSVAIAPYNKS-- 210
           PPP  Y S+P  A+F     Y   P  +P T   N+   D S +    S     ++K+  
Sbjct: 555 PPPQIY-SSPGQALFNPTNLYPTPPSSLPNTYVPNQESFDESVNRDKKSFIFNNHSKANF 613

Query: 211 KEPTLDA 231
             PTL A
Sbjct: 614 SNPTLTA 620


>U80448-5|AAB37819.1|  975|Caenorhabditis elegans Hypothetical
           protein F59A3.2a protein.
          Length = 975

 Score = 27.9 bits (59), Expect = 7.8
 Identities = 21/67 (31%), Positives = 29/67 (43%), Gaps = 4/67 (5%)
 Frame = +1

Query: 43  PPPLRYPSNPATAIFTNAQTYNNAPGYVPPTTRDNK--MDTSRSNSTNSVAIAPYNKS-- 210
           PPP  Y S+P  A+F     Y   P  +P T   N+   D S +    S     ++K+  
Sbjct: 555 PPPQIY-SSPGQALFNPTNLYPTPPSSLPNTYVPNQESFDESVNRDKKSFIFNNHSKANF 613

Query: 211 KEPTLDA 231
             PTL A
Sbjct: 614 SNPTLTA 620


>AC024824-3|AAK85501.1|  543|Caenorhabditis elegans Hypothetical
           protein Y55B1BR.1 protein.
          Length = 543

 Score = 27.9 bits (59), Expect = 7.8
 Identities = 12/38 (31%), Positives = 22/38 (57%)
 Frame = +1

Query: 58  YPSNPATAIFTNAQTYNNAPGYVPPTTRDNKMDTSRSN 171
           +PS  +T      ++  ++  Y+PP TRD  ++ SR+N
Sbjct: 466 FPSLVSTG--NTVESSEDSDTYIPPPTRDQNIERSRNN 501


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,754,920
Number of Sequences: 27780
Number of extensions: 376027
Number of successful extensions: 1645
Number of sequences better than 10.0: 28
Number of HSP's better than 10.0 without gapping: 1412
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1636
length of database: 12,740,198
effective HSP length: 80
effective length of database: 10,517,798
effective search space used: 1714401074
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -