SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120016.Seq
         (678 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U15406-1|AAA50456.1| 2272|Caenorhabditis elegans gag, pol and en...    62   4e-10
L23646-13|AAA28035.2| 2175|Caenorhabditis elegans C. elegans RET...    62   4e-10
L23646-12|AAL02516.1| 2186|Caenorhabditis elegans C. elegans RET...    62   4e-10
L23651-2|ABA54424.1|  124|Caenorhabditis elegans Hypothetical pr...    32   0.43 
Z77662-5|CAB01192.2|  579|Caenorhabditis elegans Hypothetical pr...    31   1.00 
AF067607-11|AAM81119.1|  412|Caenorhabditis elegans Innexin prot...    29   4.0  
AF067607-10|AAM81118.1|  436|Caenorhabditis elegans Innexin prot...    29   4.0  
AC024859-27|AAK29978.4|  337|Caenorhabditis elegans Hypothetical...    28   7.0  

>U15406-1|AAA50456.1| 2272|Caenorhabditis elegans gag, pol and env
            protein precursor protein.
          Length = 2272

 Score = 62.1 bits (144), Expect = 4e-10
 Identities = 27/84 (32%), Positives = 48/84 (57%)
 Frame = +1

Query: 253  IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
            I   G+ +  +KC     EV +LG++++ DG +    +   +K F  P  V+ L+ F+G+
Sbjct: 1205 IRKSGMKLRASKCHIAKKEVEYLGHKVTLDGVETQEVKTDKMKQFSRPTNVKELQSFLGL 1264

Query: 433  VNYYRRFLRNAAKLQAPLVNAIVA 504
            V YYR+F+ N A++ + L + I A
Sbjct: 1265 VGYYRKFILNFAQIASSLTSLISA 1288



 Score = 29.5 bits (63), Expect = 2.3
 Identities = 11/29 (37%), Positives = 18/29 (62%)
 Frame = +2

Query: 173  FAYVDDILVYSRDALQHAAHLRTLFKRLK 259
            F YVDD+L+ S+D  QH   ++    R++
Sbjct: 1178 FVYVDDLLIASKDMEQHLQDVKEALTRIR 1206



 Score = 27.5 bits (58), Expect = 9.3
 Identities = 15/50 (30%), Positives = 26/50 (52%)
 Frame = +3

Query: 9    DLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
            D++  + QIP+  +    TA      L+E+N + FGL  +   FQ  ++E
Sbjct: 1118 DMIAGFWQIPLDEKSKEITAFAIGSELFEWNVLPFGLVISPALFQGTMEE 1167


>L23646-13|AAA28035.2| 2175|Caenorhabditis elegans C. elegans RETR-1
            protein, isoforma protein.
          Length = 2175

 Score = 62.1 bits (144), Expect = 4e-10
 Identities = 27/84 (32%), Positives = 48/84 (57%)
 Frame = +1

Query: 253  IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
            I   G+ +  +KC     EV +LG++++ DG +    +   +K F  P  V+ L+ F+G+
Sbjct: 1108 IRKSGMKLRASKCHIAKKEVEYLGHKVTLDGVETQEVKTDKMKQFSRPTNVKELQSFLGL 1167

Query: 433  VNYYRRFLRNAAKLQAPLVNAIVA 504
            V YYR+F+ N A++ + L + I A
Sbjct: 1168 VGYYRKFILNFAQIASSLTSLISA 1191



 Score = 29.5 bits (63), Expect = 2.3
 Identities = 11/29 (37%), Positives = 18/29 (62%)
 Frame = +2

Query: 173  FAYVDDILVYSRDALQHAAHLRTLFKRLK 259
            F YVDD+L+ S+D  QH   ++    R++
Sbjct: 1081 FVYVDDLLIASKDMEQHLQDVKEALTRIR 1109



 Score = 27.5 bits (58), Expect = 9.3
 Identities = 15/50 (30%), Positives = 26/50 (52%)
 Frame = +3

Query: 9    DLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
            D++  + QIP+  +    TA      L+E+N + FGL  +   FQ  ++E
Sbjct: 1021 DMIAGFWQIPLDEKSKEITAFAIGSELFEWNVLPFGLVISPALFQGTMEE 1070


>L23646-12|AAL02516.1| 2186|Caenorhabditis elegans C. elegans RETR-1
            protein, isoformb protein.
          Length = 2186

 Score = 62.1 bits (144), Expect = 4e-10
 Identities = 27/84 (32%), Positives = 48/84 (57%)
 Frame = +1

Query: 253  IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
            I   G+ +  +KC     EV +LG++++ DG +    +   +K F  P  V+ L+ F+G+
Sbjct: 1119 IRKSGMKLRASKCHIAKKEVEYLGHKVTLDGVETQEVKTDKMKQFSRPTNVKELQSFLGL 1178

Query: 433  VNYYRRFLRNAAKLQAPLVNAIVA 504
            V YYR+F+ N A++ + L + I A
Sbjct: 1179 VGYYRKFILNFAQIASSLTSLISA 1202



 Score = 29.5 bits (63), Expect = 2.3
 Identities = 11/29 (37%), Positives = 18/29 (62%)
 Frame = +2

Query: 173  FAYVDDILVYSRDALQHAAHLRTLFKRLK 259
            F YVDD+L+ S+D  QH   ++    R++
Sbjct: 1092 FVYVDDLLIASKDMEQHLQDVKEALTRIR 1120



 Score = 27.5 bits (58), Expect = 9.3
 Identities = 15/50 (30%), Positives = 26/50 (52%)
 Frame = +3

Query: 9    DLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
            D++  + QIP+  +    TA      L+E+N + FGL  +   FQ  ++E
Sbjct: 1032 DMIAGFWQIPLDEKSKEITAFAIGSELFEWNVLPFGLVISPALFQGTMEE 1081


>L23651-2|ABA54424.1|  124|Caenorhabditis elegans Hypothetical
           protein C29E4.14 protein.
          Length = 124

 Score = 31.9 bits (69), Expect = 0.43
 Identities = 10/27 (37%), Positives = 19/27 (70%)
 Frame = -2

Query: 230 VQHVEEHHGNTLICRQRTQSKNRSFVY 150
           ++H+++H+GN +   + T SK+R F Y
Sbjct: 33  IEHLKDHYGNKIEIEKHTSSKDRKFYY 59


>Z77662-5|CAB01192.2|  579|Caenorhabditis elegans Hypothetical
           protein F47B8.5 protein.
          Length = 579

 Score = 30.7 bits (66), Expect = 1.00
 Identities = 17/71 (23%), Positives = 33/71 (46%)
 Frame = +2

Query: 218 QHAAHLRTLFKRLKITESLLIQQNACLVLLRLLFSETEYPPTEHNHHQSAFKL*KIFLYH 397
           +   H+R +F ++K+T+  +I +  CL  L   F+   +  T H H  +  K   +    
Sbjct: 289 EEVIHMRIVFAKIKLTKPAIIFEAICLFSLFSFFNFITF-STSHFHFHNKIKF--LLEGE 345

Query: 398 RLYKDSVVSLG 430
            +YK  ++  G
Sbjct: 346 TVYKQKIIENG 356


>AF067607-11|AAM81119.1|  412|Caenorhabditis elegans Innexin protein
           18, isoform b protein.
          Length = 412

 Score = 28.7 bits (61), Expect = 4.0
 Identities = 14/42 (33%), Positives = 25/42 (59%), Gaps = 3/42 (7%)
 Frame = +2

Query: 134 NVSKIYR-RSYDFCFAYVDDILVYSRD--ALQHAAHLRTLFK 250
           NV  + R ++ D    ++DD L+Y RD  A +H+ ++  +FK
Sbjct: 150 NVDPVVRDKTVDIVARHIDDALMYQRDHGARRHSVYIFAIFK 191


>AF067607-10|AAM81118.1|  436|Caenorhabditis elegans Innexin protein
           18, isoform a protein.
          Length = 436

 Score = 28.7 bits (61), Expect = 4.0
 Identities = 14/42 (33%), Positives = 25/42 (59%), Gaps = 3/42 (7%)
 Frame = +2

Query: 134 NVSKIYR-RSYDFCFAYVDDILVYSRD--ALQHAAHLRTLFK 250
           NV  + R ++ D    ++DD L+Y RD  A +H+ ++  +FK
Sbjct: 150 NVDPVVRDKTVDIVARHIDDALMYQRDHGARRHSVYIFAIFK 191


>AC024859-27|AAK29978.4|  337|Caenorhabditis elegans Hypothetical
           protein Y71H2AM.1 protein.
          Length = 337

 Score = 27.9 bits (59), Expect = 7.0
 Identities = 11/37 (29%), Positives = 22/37 (59%)
 Frame = +1

Query: 484 LVNAIVATEVKVSHRSLGHLSSKNALMPVKIACHLQL 594
           L   + A  ++++ R++ H SSK  L+   + C+L+L
Sbjct: 235 LQETVFAMLIEITERAMAHTSSKELLIVGGVGCNLRL 271


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,570,442
Number of Sequences: 27780
Number of extensions: 291430
Number of successful extensions: 786
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 751
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 786
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1539654388
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -